Entry information : EguPrx56
Entry ID 11516
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx56
Name EguPrx56
Class Class III peroxidase    [Orthogroup: Prx036]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx56
start..stop
S start..stop
EcamPrx56 643 0 1..320 1..320
EglPrx56 643 0 1..323 1..323
EgrPrx56 642 0 1..323 1..323
EgrPrx102 580 0 1..323 1..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 21830..22048 219 N° 2 22134..22322 189 N° 3 22860..23420 561  
join(21830..22048,22134..22322,22860..23420)


exon

Literature and cross-references EguPrx56
Protein sequence: EguPrx56
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   323 (297)
PWM (Da):   %s   34703.52 (32015.9)  
PI (pH):   %s   8 (7.12) Peptide Signal:   %s   cut: 27 range:27-323
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPVLALMPRXRVIVALLLAMVSVSRATLDAHYYDQTCPQAEKIILQTVQNATRHDPKVPARLLRMFFHDCFIRGCDASLLLDSTPGNQAEKDGPPNISVRAFYVIDDAKAKLEMACPXTVSCADIIAIAARDVVTMAGGPSWNVLKGRKDGRVSNASETINLPAPTFNVTQLLQSFAERGLGLKDLVALSGGHTLGFSHCSSFDARLXNFSSTHDXDPTLNHAFAXXLKNECPKPNRSRNAGQFLDATSSTFDNDYYRRLVAGEGVFGSDQALYSDYRTRWMVNLFAQDQSLFFSEFAASMVRLGNIGVREVGEVRIKCRAVN

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 2). scaffold_1_2462
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGTCCTTGCGCTGATGCCTCGCTNTCGCGTGATTGTCGCCCTTCTACTCGCGATGGTTTCGGTATCGAGAGCCACACTCGATGCCCATTATTATGACCAGACATGTCCACAAGCT
GAGAAAATCATATTGCAGACGGTTCAAAATGCCACAAGGCACGACCCCAAAGTCCCCGCTCGCCTCCTAAGGATGTTCTTCCACGACTGTTTCATTCGG
GTATGGATATCTACATACTTA
CATGCAAAATCTCTCTCTCTCTCTCTCTCTCTCTCTCACATCATTGGATGGTGCGTACCCACAGGGATGCGATGCGTCGTTGTTGCTCGACTCTACTCCTGGAAACCAAGCAGAGAAAGA
TGGTCCTCCAAATATCTCGGTTCGAGCATTCTACGTGATCGATGATGCCAAAGCAAAGCTCGAAATGGCATGTCCACANACAGTCTCTTGTGCTGATATCATCGCCATTGCNGCTAGAGA
CGTAGTTACCATG
GTAACAACCATAACTCCCCTAGCAAGCCAATTTTACCTCATGACGCACATTGTGTTCATGATCATTCCCATGTACTTCTCATAATGATTTTGAGATTTATTCTAAAT
CCAATATATAAGGCATATGAAGCTCGTTTGATTTCTACCTTGTTCACTAGATTAGTTCTAGCATGCTCGCAATTACTACACAAGATTCACTCAAAAAACTCCAAACAACTGGTTTCTAAT
GAATTACAGCAACAAGTGAGTCCAGTAAACTCGACTATCATTTCAGAAAAAAGGCTAGACTNTCGCAGTTTTAGAAAGGCAGTATCTATGAAAATAAACCAGCANGCCCGAGAGAAAAAG
GANAAGAGTTTCAAATGGTTTCCTATCTTATTACTGCATTCTGTGGTCTTGTAGTTATCACTTGATTCGCTTAAAAAGTTATTCCCTCGATAAAAGAAAAATTACTAAGGTGCTCCACAC
ATTGAACTAATTACTAACCCCTCGAGATAGTTATTATGGCATAATATTGCCTATTGTTTTCATTGTTAAGGCTGGAGGCCCATCTTGGAACGTGCTGAAAGGCAGAAAAGATGGAAGAGT
ATCAAATGCTTCAGAGACGATCAACTTGCCGGCGCCAACCTTCAACGTAACCCAACTCCTTCAAAGCTTTGCCGAAAGAGGCTTAGGCCTCAAGGACTTGGTTGCACTATCTGGTGGCCA
CACCCTGGGCTTCTCACACTGTTCCTCTTTCGACGCNCGGCTTCNTAACTTCTCTTCGACTCATGACATNGATCCGACNTTGAACCATGCGTTCGCANAACNGCTGAAGAATGAATGCCC
TAAACCAAACAGGAGTCGAAATGCGGGACAGTTTCTGGATGCTACATCGTCAACTTTTGACAACGATTACTACAGAAGACTCGTGGCGGGTGAAGGTGTGTTTGGGTCAGATCAAGCACT
GTATAGTGATTACAGGACAAGGTGGATGGTAAATTTGTTTGCCCAAGATCAAAGTCTGTTCTTCAGTGAGTTTGCAGCTTCTATGGTAAGACTCGGAAATATTGGAGTGCGAGAAGTTGG
AGAAGTGAGAATAAAATGCAGAGCGGTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCGTCCTTGCGCTGATGCCTCGCTNTCGCGTGATTGTCGCCCTTCTACTCGCGATGGTTTCGGTATCGAGAGCCACACTCGATGCCCATTATTATGACCAGACATGTCCACAAGCT
GAGAAAATCATATTGCAGACGGTTCAAAATGCCACAAGGCACGACCCCAAAGTCCCCGCTCGCCTCCTAAGGATGTTCTTCCACGACTGTTTCATTCGG
GGATGCGATGCGTCGTTGTTG
CTCGACTCTACTCCTGGAAACCAAGCAGAGAAAGATGGTCCTCCAAATATCTCGGTTCGAGCATTCTACGTGATCGATGATGCCAAAGCAAAGCTCGAAATGGCATGTCCACANACAGTC
TCTTGTGCTGATATCATCGCCATTGCNGCTAGAGACGTAGTTACCATG
GCTGGAGGCCCATCTTGGAACGTGCTGAAAGGCAGAAAAGATGGAAGAGTATCAAATGCTTCAGAGACGATC
AACTTGCCGGCGCCAACCTTCAACGTAACCCAACTCCTTCAAAGCTTTGCCGAAAGAGGCTTAGGCCTCAAGGACTTGGTTGCACTATCTGGTGGCCACACCCTGGGCTTCTCACACTGT
TCCTCTTTCGACGCNCGGCTTCNTAACTTCTCTTCGACTCATGACATNGATCCGACNTTGAACCATGCGTTCGCANAACNGCTGAAGAATGAATGCCCTAAACCAAACAGGAGTCGAAAT
GCGGGACAGTTTCTGGATGCTACATCGTCAACTTTTGACAACGATTACTACAGAAGACTCGTGGCGGGTGAAGGTGTGTTTGGGTCAGATCAAGCACTGTATAGTGATTACAGGACAAGG
TGGATGGTAAATTTGTTTGCCCAAGATCAAAGTCTGTTCTTCAGTGAGTTTGCAGCTTCTATGGTAAGACTCGGAAATATTGGAGTGCGAGAAGTTGGAGAAGTGAGAATAAAATGCAGA
GCGGTGAAC

Retrieve as FASTA