Entry information : EguPrx59
Entry ID 11518
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-02-05 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-05 (Achraf Jemmat)
Peroxidase information: EguPrx59
Name EguPrx59
Class Class III peroxidase    [Orthogroup: Prx021]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx59
start..stop
S start..stop
EglPrx59 663 0 1..332 1..332
EgrPrx59 633 0 1..332 1..332
EcamPrx59 566 0 1..332 3..334
MePrx135 472 5e-169 1..331 1..328
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11113..11331 219 N° 2 12180..12353 174 N° 3 12519..12693 175 N° 4 13094..13521 428
join(11113..11331,12180..12353,12519..12693,13094..13521)


exon

Literature and cross-references EguPrx59
Protein sequence: EguPrx59
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   332 (306)
PWM (Da):   %s   34724.19 (31800.6)  
PI (pH):   %s   7.34 (6.01) Peptide Signal:   %s   cut: 27 range:27-332
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSRGASFRSWSLRWVVLLICFVGGKSQLTTDFYSTSCPNVLSIVRKQVQNAIKAEMRMGASLLRLHFHDCFVNGCDGSVLLDGSDGEKFAGPNLNSARGFDVVDNIKTAVESSCSGVVSCADILAIAARDSHVQSGGPTWKVPLGRRDGLVANQTGSNXGLPAPTDPLDTIISKFAAVGLNVTDVVALSGGHTIGLARCATFSNRLFNFSANSGSDPTLDTTMTSDLQSLCPVNGDGNKTTALDRNSTDLFDNHYFKNLAVNKGLLSSDQVLYSGDSSTASSTTKSLVESYGSNPNLFITDFTNSMIKMGSISPLTGSXGEIRKNCRVXNS

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_2_5673 (11113..13521)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACCAGTTGTCCTAATGTG
CTCAGCATAGTGAGGAAACAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GTATGTCATGTGTTTAATATC
AATAACTTGATCGTTACCGTACCATGCAATCAACGACTAGGTTTCTTACGTGATCAATTATATAAATTGTTGTTTCAATTTTGTGTTATTGTTCTTCTAAGTGGGCAGTTTCTTGTAATT
GGTAAATATTAATAAGCTTGAGATATTGGTTCTCTTGTTCGTAGGTTCTATGTGGACTCGAATAGGTTTTTAACAAGTGGAAATAATTGGGAGAATTTNNNNNNNNNNNNNTAATTGGGA
GAATTTGAGTATAGACTTTTGTCCCTAAGCAATTTCAAATGGTAAATATGAGTAAAATGCTTTTCCGCGATTGATTTTCTATGAAACTAATATGAGCTATCATCATATGCACTTAAAATT
GAAGTCTAGCTTTTACTCTCACCCAAGACCAAGTCGAGCTATTATTAGAAACACTAGGTTCTAGGAACCCAATGCACTTGATGTGCCNCGGCTGTTAAATCATGTGAATTTCCCGCAAAC
TCAAACAAAAGATTGATGCNCCTGGCAAGGGACATCATTGTTTCGCAAAATAAGTTAGTGAACAATAAAGGTACTTCTTGACCATTCCAAGAACGAGAAAGTCAATCTTCTAATCCTCTT
TTTGGAAAAGTAAGTTACCTGCATGTTAGTTTCCTCAGTCATCCTAGGACTTCCTAGTATTCCGAAGGCTAGGGATATGNATATACATCAGAACAGGACATGAGAGGCTACCCATTCAAT
CGTCCTCTTTTCCCCATCTTACATTGACTTATCAGCCCTTCATGCTTTCATCATCATTCATGGCTTATATGTTCNCCTGTGAATACTTCACTCTGCTCACACACCAGGGATGCGATGGAT
CGGTTCTCCTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGCGGCGTTG
TATCNTGTGCCGACATCTTAGCCATAGCCGCCAGAGATTCC
GTGCTCTTGGTAAGTGCCAATCTGNATGAATACGAGAAATCNAAAGAGTTTTGTCTGGATTCCACCAAAAAATACAAGA
ATCAACGGTACCCCGTAAACTATAAATAATTTGGTCCACTGTATTCATCGCAAACTCGGTAAGAAAGTAACTGTATCTGATGGATCCATGTGCAGAGCGGGGGGCCGACATGGAAAGTTC
CACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACANTGGCCTTCCTGCTCCTACCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCA
CAGATGTGGTAGCTTTATCAG
GTACTCTTCTTTTTCTCTTCCTTTTTTCTTTCTCTCTTTGGATCAGTGCTTTATCCGGTACTTTGAGGACACTCCTCAGTCATTCTAATTTCTATACAA
ACTGCGTATTGGTATCCCTCGTTCAATCAAGAGGCTAGTTAGTGNCTACCATGTTTGATATTTTAACATCCATCTAAAATCAAAGTGATTGTAGTTACTGATCACGCTTAAATTAGGCAA
CAAAACTCTGACGGCGTNGTCACCTCTCTGTATGTTCATATCGAATCATGCAGATCTTGTTGTAAATTATAACCATTTCCAGATCCATCTGAAGTTTCCTGAGANAGAGCATGTGCAACT
CTTAATGGTGTATAGGATGATCATTTCATGCACTGCTGAACAAAAAGAGGTTTATGTACAGGTGGTCATACAATTGGATTAGCAAGGTGCGCCACCTTCAGCAACAGATTGTTCAACTTT
TCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGACGGAAACAAGACGACGGCCCTAGACCGCAACTCAACCGAT
CTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCCAGTTCTACTACAAAAAGTCTAGTAGAA
TCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACTGGTTCANAGGGNGAGATTCGGAAGAACTGTAGAGTGGNT
AACTCTTCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTAGAGGTGCAAGCTTTAGGAGTTGGTCTTTGCGATGGGTGGTTCTCTTGATCTGTTTTGTGGGTGGGAAATCTCAGCTCACAACAGATTTCTACTCCACCAGTTGTCCTAATGTG
CTCAGCATAGTGAGGAAACAAGTTCAAAATGCTATCAAGGCTGAAATGAGAATGGGTGCTTCCTTGCTCCGGCTTCACTTCCATGATTGCTTTGTCAAT
GGATGCGATGGATCGGTTCTC
CTGGATGGAAGTGATGGCGAGAAGTTTGCTGGCCCCAACCTTAACTCCGCTCGGGGGTTCGATGTCGTGGACAACATCAAAACTGCTGTGGAGAGTTCGTGCAGCGGCGTTGTATCNTGT
GCCGACATCTTAGCCATAGCCGCCAGAGATTCC
CATGTGCAGAGCGGGGGGCCGACATGGAAAGTTCCACTGGGAAGAAGGGATGGGTTAGTGGCGAATCAGACTGGTTCAAACANTGGC
CTTCCTGCTCCTACCGATCCTTTAGACACTATCATCTCCAAGTTTGCCGCCGTTGGCCTCAATGTCACAGATGTGGTAGCTTTATCAG
GTGGTCATACAATTGGATTAGCAAGGTGCGCC
ACCTTCAGCAACAGATTGTTCAACTTTTCGGCGAATTCAGGCTCAGACCCCACGCTTGACACAACTATGACATCGGACCTGCAAAGCCTATGCCCTGTGAATGGCGACGGAAACAAGACG
ACGGCCCTAGACCGCAACTCAACCGATCTATTCGACAACCATTACTTCAAGAATCTAGCTGTAAACAAGGGCCTTCTCAGTTCGGATCAGGTTCTCTATTCTGGTGACAGCAGCACAGCC
AGTTCTACTACAAAAAGTCTAGTAGAATCCTATGGCAGCAACCCCAACCTTTTCATCACCGATTTTACCAACTCAATGATCAAGATGGGAAGCATCAGTCCACTCACTGGTTCANAGGGN
GAGATTCGGAAGAACTGTAGAGTGGNTAACTCTTCA

Retrieve as FASTA