Entry information : EguPrx60
Entry ID 11519
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx60
Name EguPrx60
Class Class III peroxidase    [Orthogroup: Prx034]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx60
start..stop
S start..stop
EglPrx60 706 0 1..344 1..344
EgrPrx60 706 0 1..344 1..344
EcamPrx60 666 0 1..344 1..344
CroPrx18 530 0 17..339 1..324
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 52931..53170 240 N° 2 52318..52509 192 N° 3 52002..52164 163 N° 4 50829..51265 437
complement(join(50829..51265,52002..52164,52318..52509,52931..53170))


exon

Literature and cross-references EguPrx60
Protein sequence: EguPrx60
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   344 (315)
PWM (Da):   %s   37154.53 (33903.8)  
PI (pH):   %s   5.41 (4.79) Peptide Signal:   %s   cut: 30 range:30-344
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATSSPRSMPRFSKFLALFLLLGFGKTYCAXDPPLTLDYYKSSCPSVLEIVRKEMECXVLSDPRNAALIIRLHFHDCFVQGCDGSVLLDDTITLQGEKKAPPSINSLGGFRIVDRIKNMLESECPGVVSCADILTVAARDATLLVGGPYWDVPLGRKDSRTAGYELASAIPTADESLPSIISKFLFQGLSVTDMVALAGAHTVGMARCENFRARIYGDFEATSGASPASEAYLGHLKSVCPPIGGGNNNVAPMDSVTPNLFDNSFYHLLLQGEGLLNSDQEMYSSILAVQTREIVKKYAADPIAFFQQFSESMVRMGNITNPESFVNGEVRKNCRFINTWAPE

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_2_6168 (53170..50829)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGATGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCNGCGACCCTCCNTTGACGTTGGATTACTAC
AAGTCNTCGTGTCCGTCGGTGCTTGAGATTGTGAGGAAGGAGATGGAATGCNCTGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GTTCGTTTTCATTTTGTATNGTATTTTCNCGTAGGCCGGACTAGCCACCTTTGCAAGCTTGCTAAGGTTTGAACTTGGTAGACACAATGGGTATTTCTATATTCGATTTCAAGGGGACCG
ATGTGTCTCTGTGTTCGTAGATATATATACCTGATTCGGCCCAGTGAATGATTAATTTTCAAGAAGGGNTGCCACCAATCTCATTTTTACANATCAACTTCANTATGTACATGTGAAAAT
NTCTTTCTACTAATTGTGCACTAAGCTGAGAGATTTGAATGTGGGAGACACGATCAATAAGNCTANAGCTCGAGCTAGTAACCACAATTAGAATAAGATGAAGCTAACCAGAGGTTATTA
GAACCTGTAAAATNGTGATCGGTCCTTTGTTTTTCCCCTAANAATTGGGATACGAGNATAGGGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCAAGGAGAGAAGAAAGC
TCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTTGAATCCGAGTGCCCNGGAGTTGTCTCTTGCGCCGACATACTCACGGTTGCCGCAAGAGA
TGCTACGCTTTTG
GTATGTCCGCTAACTTTCGTCTCTTTTCAAGCATAAAANCATAGATTACTCCATTTCGTCATTCATGTCCTTATGCNATCGCTAGTCGTGGTGTTAAACTTAAGACN
AAGTTCTAATGCGATGATAAATTGTAATCTTTTGGATTTCGCCAAGGTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGGACAGCGGGCTACGAGCTCGCCTCCGC
CATCCCGACAGCTGACGAGAGCCTTCCGTCCATCATCTCCAAATTTCTCTTCCAAGGCCTCTCCGTCACCGACATGGTCGCTCTCGCCG
GTAAATTAACTAAGCTCAAGAATGTCCTATC
ACGCGATCGATTACGTGCTCTTTAAATAATTTTAATGTCCTATGATTTTGCTAACTTCTCGAGTGTCGGANGAATATGCTGATGGCTACATAATAGATTCCACCTCCAGACTGCAGATTG
ATGTTGTTATTGAATGCGACTTCGTGTAAAGCTAACTCTACCTAATATTTCCCCCAACCACATGTGCACCCGTCTCTAAAACGTCTTATTCTCCGGTCNAAATCAAATTCTCAAGGAAAA
ATATAATGTCCCTTATAAATTATGATGTATTTCTAAACATTTCATTTAGCCACGCCCACAAAAAAACAGAAATTTCAATTGTACATGACTGTTGAGTCTGTTCGGTCCTAATTAGATTCT
AGCTTCCTCTGGTAATAAAATATCGAGAAGAATCACGACGAGCGGAAAGGATAAGGCTTTAGCCTCAGGTAGCGTGGACCAATTCAAGATCGAATTTCCATTTTATTATCGAAATTTGTA
CTATCGTACACAAAAGGAGAGGCTAAAAAGCGATGCAAGGTTCATTAATCTGAGTGGAAGAAAAGAAAGATGAATCNTCACGCAACATACGAAAGTGGAGACTTGCGGTCCATGTTATGG
ACATGTCGACTATTCTTTGGCATGCTCTAACCTAACGAACGACACCAATCATGTAGTGATGACAAATTTCTGCCCTTTTTCCAATTGATGGATGTGCATAATTAGGNGCTCACACGGTGG
GGATGGCNCGGTGCGAGAATTTCCGAGCGCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAGAGGCGTACCTCGGCCACTTGAAGTCGGTCTGCCCCCCGATAG
GGGGAGGAAACAACAACGTGGCGCCTATGGATTCCGTGACTCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGACCAGGAAATGTACT
CGAGCATCCTGGCGGTCCAGACGAGGGAAATCGTGAAGAAGTACGCGGCCGACCCGATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACATCACGAACCCGGAAA
GCTTCGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTCATAAACACATGGGCTCCAGAGATC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAACTTCATCGCCACGCTCGATGCCCCGATTTTCCAAATTCCTGGCTCTCTTTCTCTTGTTAGGCTTCGGCAAAACATATTGCGCCNGCGACCCTCCNTTGACGTTGGATTACTAC
AAGTCNTCGTGTCCGTCGGTGCTTGAGATTGTGAGGAAGGAGATGGAATGCNCTGTGCTCTCTGACCCTCGCAATGCCGCATTGATCATTCGGTTGCATTTCCACGACTGCTTTGTTCAG
GGATGCGACGGGTCGGTTTTGCTAGATGACACTATCACGCTCCAAGGAGAGAAGAAAGCTCCCCCCAGCATAAATTCTCTAGGAGGGTTCAGGATCGTCGACCGCATCAAGAACATGCTT
GAATCCGAGTGCCCNGGAGTTGTCTCTTGCGCCGACATACTCACGGTTGCCGCAAGAGATGCTACGCTTTTG
GTTGGTGGACCTTATTGGGACGTACCCTTGGGAAGGAAGGACTCGAGG
ACAGCGGGCTACGAGCTCGCCTCCGCCATCCCGACAGCTGACGAGAGCCTTCCGTCCATCATCTCCAAATTTCTCTTCCAAGGCCTCTCCGTCACCGACATGGTCGCTCTCGCCG
GNGCT
CACACGGTGGGGATGGCNCGGTGCGAGAATTTCCGAGCGCGGATCTACGGGGACTTTGAAGCGACATCCGGGGCCAGTCCTGCCTCAGAGGCGTACCTCGGCCACTTGAAGTCGGTCTGC
CCCCCGATAGGGGGAGGAAACAACAACGTGGCGCCTATGGATTCCGTGACTCCCAACCTGTTCGACAACTCCTTCTATCACCTGCTCCTACAGGGGGAGGGCCTGCTCAACTCGGACCAG
GAAATGTACTCGAGCATCCTGGCGGTCCAGACGAGGGAAATCGTGAAGAAGTACGCGGCCGACCCGATCGCCTTCTTTCAGCAGTTCTCGGAGTCGATGGTGAGGATGGGGAACATCACG
AACCCGGAAAGCTTCGTCAATGGGGAAGTGAGGAAGAACTGTAGGTTCATAAACACATGGGCTCCAGAGATC

Retrieve as FASTA