Entry information : EguPrx61
Entry ID 11520
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-23 (Christophe Dunand)
Peroxidase information: EguPrx61
Name EguPrx61
Class Class III peroxidase    [Orthogroup: Prx002]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx61
start..stop
S start..stop
EgrPrx61 682 0 1..329 1..329
EcamPrx61 678 0 1..329 1..329
EglPrx61 622 0 1..329 1..329
PtPrx15 501 0 2..326 3..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 54917..55117 201 N° 2 55559..56344 786  
join(54917..55117,55559..56344)


exon

Literature and cross-references EguPrx61
Protein sequence: EguPrx61
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   329 (310)
PWM (Da):   %s   36423.34 (34218.1)  
PI (pH):   %s   8.19 (8.18) Peptide Signal:   %s   cut: 20 range:20-329
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTPFHLLLLFLVFFNIATSSESKLTLDYYKKTCPGLQQTIRQVITDKQIASSTTAAATLRLFFHDCMVNGCDGSILVSSNAFNTAERDADINLSLPGDGFEVVTRAKTALELECPDIVSCADILALAARDLVTMVGGPYYDVRLGRKDGFVSKASEAEAAMPKPTMPLSQIIKIFEARGLSVQEMVALTGAHTIGFTHCKEFSHRLYNFSKKSNYDPTLYPKYAEGLRKLCENYTKDPTMSAFNDVMTPNKFDNMYYKNLQKGLGLLTSDQAMAVDGRTKPYVDLYAGNQTAFFQAFARAIEKVSVYQVKTGRKGEVRHRCDAFNSLQT

Retrieve as FASTA  
Remarks Complete sequence from genomic (intron 1).
scaffold_2_6311 (54917..56344)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCTGGCCTCCAACAAACCATC
CGACAAGTCATCACCGACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
GTAATTGGAGTGAATGAATGTCCCATTATGTTTTAGGTA
CACAAATTCTAATTTGCGAAATCCGCGTTGACGAGTGNATATCGGTTCGACTGCGGTAGTATCATGTCAGGCTACGTGTTAAGGTTTTCCAAGCCTTCCCGTCCAATTTAGATTCATCTT
GATTGAGAGACTAGATTGATGCTTTGCCNACGTAACGATGCATGGAGAAAAGGATCTCGACAGCATTATGCACAAAATGCAACTATCAATACGTCGCGGGAAATTTGTACTAAATACAAA
ATAAGGGATCTTGAAAAATATTAGGATGTCTTTCTGTAGAATACGAGACTCGATCTGCAAGTTATTGATGTATCGATGAGAAGTATTTTGATTTGGAGTTAGCCCTAACGGTGTTTATAT
TCGATNGGNATTGAACTTTGATGAAACTGAATATCCCAACAGGTAAATGGTTGCGACGGCTCCATCCTCGTCTCCTCCAACGCGTTCAACACTGCTGAACGCGATGCCGACATCAACCTC
TCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGTGCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGACC
ATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGGAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCCGCCATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCAAA
ATCTTCGAGGCGCGAGGGCTCAGCGTGCAAGAGATGGTGGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAGGAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAATCG
AACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATGTCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCGAC
AACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGACCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAGCCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCTTC
TTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGGTGCGACGCCTTCAACTCCCTCCAGACT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGCCCTTTCACCTCCTCCTCCTCTTCCTTGTCTTCTTCAACATCGCAACCTCCTCGGAATCGAAGCTCACCCTCGACTACTACAAGAAGACATGCCCTGGCCTCCAACAAACCATC
CGACAAGTCATCACCGACAAGCAGATCGCCTCCTCCACCACCGCGGCCGCCACCCTCCGCCTCTTCTTCCATGATTGCATG
GTAAATGGTTGCGACGGCTCCATCCTCGTCTCCTCCAAC
GCGTTCAACACTGCTGAACGCGATGCCGACATCAACCTCTCCCTCCCCGGCGATGGTTTCGAAGTCGTCACCCGTGCCAAAACCGCTCTCGAGCTCGAATGCCCCGACATTGTGTCGTGT
GCGGATATCCTCGCCCTCGCTGCCCGCGACCTCGTGACCATGGTCGGTGGCCCCTACTACGACGTCCGCTTGGGCCGGAAGGACGGCTTCGTCTCGAAAGCATCCGAAGCCGAGGCCGCC
ATGCCGAAGCCGACCATGCCCCTGAGTCAGATCATCAAAATCTTCGAGGCGCGAGGGCTCAGCGTGCAAGAGATGGTGGCTCTGACCGGGGCGCACACGATCGGCTTCACGCACTGCAAG
GAGTTCAGCCACAGGCTGTACAATTTCAGCAAGAAATCGAACTACGACCCAACGCTCTACCCCAAGTACGCGGAAGGGCTGAGGAAGCTCTGCGAGAACTACACCAAGGACCCCACGATG
TCGGCGTTCAACGACGTGATGACGCCGAACAAGTTCGACAACATGTACTACAAGAACCTCCAGAAAGGACTGGGGCTGCTGACCTCAGACCAGGCGATGGCGGTGGACGGGAGGACGAAG
CCGTACGTGGACCTGTATGCGGGGAACCAGACGGCCTTCTTCCAGGCGTTCGCCCGAGCCATCGAGAAGGTGAGCGTGTATCAGGTGAAGACGGGGAGGAAGGGAGAGGTGAGGCACAGG
TGCGACGCCTTCAACTCCCTCCAGACT

Retrieve as FASTA