Entry information : EguPrx62
Entry ID 11521
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx62
Name EguPrx62
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx62
start..stop
S start..stop
EgrPrx62 726 0 1..363 1..363
EglPrx62 724 0 1..363 1..363
EcamPrx62 658 0 1..331 1..331
EguPrx63 605 0 1..360 1..357
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 40193..40423 231 N° 2 39838..40017 180 N° 3 39520..39679 160 N° 4 38877..39394 518
complement(join(38877..39394,39520..39679,39838..40017,40193..40423))


exon

Literature and cross-references EguPrx62
Protein sequence: EguPrx62
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   363 (335)
PWM (Da):   %s   38026.64 (35422.2) Transmb domain:   %s   i7-29o
PI (pH):   %s   9.13 (9.09) Peptide Signal:   %s   cut: 29 range:29-363
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MATLRAGAALGLALIGLVLASLSGSCHGALQVGFYNGKCRVSDVEAIVAGVVASRFSKDPTVAPALLRMQFHDCFVTGCDASILLDGKSSEKTAPPNLSVKGYDVIDSAKAAVEAICPGVVSCADIIVMATRDAVSLSGGGRYRVETGRKDGLVSLASNVNLPPPSISVNXSIAAFAQKGLTVSDMVLLLGGHTIGIAHCSLFQDRLYNYQNTGKPDPTMDPSLASALRSTCPNKQTNVDNIVNLDQDPLSSSIVDNSFYKQILARRGILQIDQEIALDXQTKDIVGAIAGRLDFSTRFGQAMVKLGTLQNGAPGEIRQSCRAINTARKLPTSKDKQRMGRTGWTRWSGDPRALSIQKRGSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_2_6484 (40423..38877)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGCTGCGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCACGGTGCTCTTCAGGTCGGGTTCTACAATGGCAAATGTAGG
GTCTCGGATGTCGAGGCCATCGTGGCCGGNGTCGTGGCGTCCCGGTTCAGCAAGGACCCCACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACG
GTAAACTAA
TTAGCCTAAATTACTTCATGAAAAGCNACTTAAATGTTCAATTTGGTTCCCCCGCACGTGCTTTAGAACTAGTCTATTGACTAATAAAGAAATTATGTAGATGGATGGGATTGTGTAAGA
CCGGCTCGTTTTGTATGTTAAAATGTTACAATGACTAAATAATTAGGGCTGCGACGCCTCCATTCTTCTGGACGGAAAATCGAGCGAGAAGACTGCGCCGCCAAATTTGAGCGTCAAGGG
CTACGATGTCATTGACTCCGCAAAGGCCGCTGTGGAGGCCATATGCCCCGGGGTTGTTTCCTGCGCCGATATCATTGTCATGGCAACTAGAGATGCCGTGTCCCTG
GTAATTAAATCGTA
TTTTCCGCATAACTCATGATAAGATGCATGCGCTAAGCGTCTCGATCCAGTGACATTCTGCTCTTCTCATATGCTATACTTATATACACATTGGCTTAGTAAATTTCATGACGTACGCGT
GAGACACATGCTCAAATATTGCAGAGCGGAGGAGGTCGGTACAGGGTAGAAACGGGACGGAAAGACGGGCTCGTATCGCTCGCGTCCAACGTCAATCTCCCCCCTCCCTCCATCTCCGTC
AATGANTCCATCGCGGCATTCGCTCAAAAAGGACTCACCGTTTCCGACATGGTCCTTCTTCTAG
GTACGTATATGCAGCATCGTCGTCCCCAATCAATTGAAAACCCCAGATCCATGCAA
ATAAGTTCGAAAGTTGTAGTCTGGTATGGTGTTTGTTCTTATAAAAAACTGCTACTGGTCGTGTCCTAGGTGGCCACACGATCGGCATTGCTCACTGCTCGCTCTTCCAAGACCGGCTTT
ACAATTACCAGAATACCGGGAAACCTGACCCAACCATGGACCCTTCCTTGGCTTCCGCCCTAAGGTCGACGTGCCCTAACAAGCAGACTAACGTCGACAACATTGTCAATCTCGACCAGG
ATCCTCTGAGCTCATCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCGTAGAGGGATTCTGCAGATCGATCAGGAGATCGCGCTGGACAGNCAGACCAAGGACATTGTGGGAG
CGATCGCCGGCAGACTTGACTTCTCGACTAGGTTTGGCCAAGCNATGGTTAAGTTGGGCACACTCCAGAATGGCGCTCCTGGGGAGATAAGGCAATCCTGCAGAGCTATCAATACGGCTC
GTAAGCTGCCTACTTCCAAAGATAAGCAGAGGATGGGCCGGACAGGGTGGACGCGGTGGAGCGGTGACCCGAGAGCCCTTTCGATTCAGAAGCGTGGCTCTTCAGAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGACGCTGCGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCACGGTGCTCTTCAGGTCGGGTTCTACAATGGCAAATGTAGG
GTCTCGGATGTCGAGGCCATCGTGGCCGGNGTCGTGGCGTCCCGGTTCAGCAAGGACCCCACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACG
GGCTGCGAC
GCCTCCATTCTTCTGGACGGAAAATCGAGCGAGAAGACTGCGCCGCCAAATTTGAGCGTCAAGGGCTACGATGTCATTGACTCCGCAAAGGCCGCTGTGGAGGCCATATGCCCCGGGGTT
GTTTCCTGCGCCGATATCATTGTCATGGCAACTAGAGATGCCGTGTCCCTG
AGCGGAGGAGGTCGGTACAGGGTAGAAACGGGACGGAAAGACGGGCTCGTATCGCTCGCGTCCAACGTC
AATCTCCCCCCTCCCTCCATCTCCGTCAATGANTCCATCGCGGCATTCGCTCAAAAAGGACTCACCGTTTCCGACATGGTCCTTCTTCTAG
GTGGCCACACGATCGGCATTGCTCACTGC
TCGCTCTTCCAAGACCGGCTTTACAATTACCAGAATACCGGGAAACCTGACCCAACCATGGACCCTTCCTTGGCTTCCGCCCTAAGGTCGACGTGCCCTAACAAGCAGACTAACGTCGAC
AACATTGTCAATCTCGACCAGGATCCTCTGAGCTCATCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCGTAGAGGGATTCTGCAGATCGATCAGGAGATCGCGCTGGACAGN
CAGACCAAGGACATTGTGGGAGCGATCGCCGGCAGACTTGACTTCTCGACTAGGTTTGGCCAAGCNATGGTTAAGTTGGGCACACTCCAGAATGGCGCTCCTGGGGAGATAAGGCAATCC
TGCAGAGCTATCAATACGGCTCGTAAGCTGCCTACTTCCAAAGATAAGCAGAGGATGGGCCGGACAGGGTGGACGCGGTGGAGCGGTGACCCGAGAGCCCTTTCGATTCAGAAGCGTGGC
TCTTCAGAC

Retrieve as FASTA