Entry information : EguPrx63
Entry ID 11522
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx63
Name EguPrx63
Class Class III peroxidase    [Orthogroup: Prx033]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx63
start..stop
S start..stop
EgrPrx63 673 0 1..358 1..358
EcamPrx63 664 0 24..358 23..357
EguPrx62 631 0 1..357 1..360
EgrPrx62 624 0 1..357 1..360
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2057..2287 231 N° 2 1669..1848 180 N° 3 1355..1514 160 N° 4 743..1245 503
complement(join(743..1245,1355..1514,1669..1848,2057..2287))


exon

Literature and cross-references EguPrx63
Protein sequence: EguPrx63
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   358 (338)
PWM (Da):   %s   37261.16 (35397.1) Transmb domain:   %s   i7-29o
PI (pH):   %s   8.32 (8.14) Peptide Signal:   %s   cut: 29 range:21-358
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTTARAGAALGLALIGLVLASLSGSCQGALQVGFYNGKCGFSDVEAIVAGVVATQIGKDPTVAPALLRMQFHDCFVTGCDASILLDGKSSEKTAPPNLSVRGYDVIDAVKAAVEAXCPGVVSCADIIVMATRDAVSLSGGGRYKVETGRKDGLVSLASNVNLPPPSISVDNSIAAFAQKGLNVSDMVLLLGGHTIGVAHCSLFQDRLYNFQSTGKPDPTMDPSLASALRSTCPNPQTNVDNIVNLDQNRLSASIVDNSFYKQILAHRGILQIDQEIALDGQTKDIVGAIAGGLDFSARFGQAMVKLGTLQNGSPGEIRQSCRAINTARKLPTSKDEQSTGKRQQRDNLRARSIPKRG

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_2_6485 (2287..743)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACGGCACGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCAAGGTGCGCTTCAGGTTGGGTTCTACAATGGCAAATGTGGG
TTCTCGGATGTCGAGGCCATCGTGGCCGGCGTCGTGGCGACCCAGATCGGGAAAGACCCTACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACT
GTAAGCTAA
TTAGCCTAAATTATTTCATAATAAGCTACTTAAATATTTGATTCGGTTCCCACGCAGGTGCTTTAGAACTAGTCAATTGACTAAAAAAGAAATTATTTAGATGGACAGGATTGTTTAATA
CCAGCACGTTTTGTATGTTANAATGTTATGATGACTAGATAAATATCATCGGATTTCATTTTGATACGATGAAAATTAGGGTTGCGACGCTTCCATTCTTCTGGATGGAAAGTCGAGCGA
GAAGACGGCACCACCGAATTTGAGCGTCAGAGGCTACGATGTCATTGACGCAGTGAAGGCCGCCGTGGAGGCCNTATGCCCCGGAGTCGTTTCCTGTGCCGATATCATTGTAATGGCCAC
AAGGGACGCCGTCTCCTTG
GTAATTAAATCGTACTTTTTGCACAATGCATGATAAGATGTATACACCANGTGTCTCGATCCGGTTTCATTTTGCTCCTCATATGCTATACTTATATACGC
ATTAGCTTAGTAAATTTCGTGACGTACAAGTGACACATGCTCAAATATTGCAGAGCGGAGGAGGTCGGTACAAGGTAGAAACGGGACGAAAAGACGGGCTCGTATCACTCGCATCCAACG
TCAATCTGCCCCCTCCCTCCATCTCCGTCGACAACTCCATCGCGGCGTTCGCTCAAAAGGGACTCAACGTTTCCGACATGGTCCTTCTTCTAG
GTACATATATGCGGCAGTTGAAAAGCC
TAGATCCATGTAAATAAGTATGAAAGTTGTAGCGTGGTATTAGTGTTTGTTCCTGAAAAAACTGTTATCGGTGGTGTCCTAGGTGGCCACACGATCGGCGTTGCTCACTGCTCGCTCTTC
CAAGACCGCCTGTACAATTTCCAGAGTACCGGGAAACCCGACCCAACCATGGACCCTTCATTGGCTTCCGCCCTAAGGTCGACGTGCCCTAACCCTCAGACTAATGTCGACAACATTGTC
AATCTCGACCAGAACCGTTTGAGTGCTTCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCATAGAGGGATACTGCAGATCGATCAGGAGATCGCACTGGACGGGCAGACCAAA
GACATTGTGGGAGCGATCGCGGGTGGGCTCGACTTCTCGGCTAGGTTCGGCCAAGCCATGGTCAAGTTGGGCACACTCCAGAATGGCTCCCCGGGGGAGATAAGGCAATCCTGCAGAGCT
ATCAACACGGCTCGTAAGCTGCCTACTTCCAAAGATGAGCAGAGTACAGGCAAGAGGCAGCAGAGAGACAACCTGAGAGCCCGTTCAATTCCAAAGCGTGGATTT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACTACGGCACGAGCAGGTGCTGCTTTGGGACTGGCCCTGATCGGCCTCGTGTTGGCGAGCCTGAGCGGGTCTTGCCAAGGTGCGCTTCAGGTTGGGTTCTACAATGGCAAATGTGGG
TTCTCGGATGTCGAGGCCATCGTGGCCGGCGTCGTGGCGACCCAGATCGGGAAAGACCCTACCGTCGCCCCCGCTCTCCTCCGCATGCAGTTTCATGATTGCTTCGTCACT
GGTTGCGAC
GCTTCCATTCTTCTGGATGGAAAGTCGAGCGAGAAGACGGCACCACCGAATTTGAGCGTCAGAGGCTACGATGTCATTGACGCAGTGAAGGCCGCCGTGGAGGCCNTATGCCCCGGAGTC
GTTTCCTGTGCCGATATCATTGTAATGGCCACAAGGGACGCCGTCTCCTTG
AGCGGAGGAGGTCGGTACAAGGTAGAAACGGGACGAAAAGACGGGCTCGTATCACTCGCATCCAACGTC
AATCTGCCCCCTCCCTCCATCTCCGTCGACAACTCCATCGCGGCGTTCGCTCAAAAGGGACTCAACGTTTCCGACATGGTCCTTCTTCTAG
GTGGCCACACGATCGGCGTTGCTCACTGC
TCGCTCTTCCAAGACCGCCTGTACAATTTCCAGAGTACCGGGAAACCCGACCCAACCATGGACCCTTCATTGGCTTCCGCCCTAAGGTCGACGTGCCCTAACCCTCAGACTAATGTCGAC
AACATTGTCAATCTCGACCAGAACCGTTTGAGTGCTTCGATCGTCGACAACTCCTTCTACAAGCAGATACTCGCCCATAGAGGGATACTGCAGATCGATCAGGAGATCGCACTGGACGGG
CAGACCAAAGACATTGTGGGAGCGATCGCGGGTGGGCTCGACTTCTCGGCTAGGTTCGGCCAAGCCATGGTCAAGTTGGGCACACTCCAGAATGGCTCCCCGGGGGAGATAAGGCAATCC
TGCAGAGCTATCAACACGGCTCGTAAGCTGCCTACTTCCAAAGATGAGCAGAGTACAGGCAAGAGGCAGCAGAGAGACAACCTGAGAGCCCGTTCAATTCCAAAGCGTGGATTT

Retrieve as FASTA