Entry information : EguPrx67
Entry ID 11526
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx67
Name EguPrx67
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx67
start..stop
S start..stop
EgrPrx67 647 0 1..325 1..325
EcamPrx67 640 0 1..325 1..325
EguPrx68 640 0 1..325 1..325
EglPrx67 638 0 1..325 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1096..1302 207 N° 2 1405..1602 198 N° 3 2176..2341 166 N° 4 2963..3366 404
join(1096..1302,1405..1602,2176..2341,2963..3366)


exon

Literature and cross-references EguPrx67
Protein sequence: EguPrx67
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (303)
PWM (Da):   %s   34608.66 (32314.4)  
PI (pH):   %s   9.48 (9.47) Peptide Signal:   %s   cut: 23 range:23-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARRFLVSCLSFALLLSAVSXQLRTDFYKNXCPNVESLVRSAVTKKFQQTFVTAPATLRLLFXDCFVRGCDGSVLIASPTNNAEKDHPDDLSLAGDGFDTVIKAKAAVDSVPQCKNKVSCADILALAARDVVSLAGGPFYSVELGRRDGRISTKLSVQHNLPQPGSKLDQLNSMFSSHGLSQTDMIALSGAHTIGFSXCGKFSKRIYNFSPRSSIDPTLNFGYALQLRQMCPIKVDXRIAINMDPTTPQTFDNAYYKXLQQGKGLFVSDQTLFSDPRSRATVNLFASNNAAFRQAFVTAITKMGRIGVKTGNQGEIRIDCTRX

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_3_9149 (1096..3366)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTAAGTGCAGTCTCGGNTCAGCTCAGGACGGATTTCTACAAGAACNCGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCTGCAACTCTCCGCCTCTTGTTCCANGATTGCTTCGTCAGG
GTTGGTTTTGAAACAAAGTATTCTATACATAAT
AATGTTGGCTTGATTGTTAATTGTTTGCTTCTTCTTCTTCTTTTTCGTTCGTTTTGGGGATTTGATTAGGGATGCGATGGTTCAGTGCTCATAGCGTCGCCCACCAACAACGCCGAGAAA
GACCATCCCGATGACCTGTCGCTCGCCGGCGACGGCTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCTTGTGCCGATATCTTGGCT
CTTGCCGCTAGAGATGTCGTTTCGTTG
GTACGATAAGGGCCCCCCACTGAACTCCTTTCCCAATTTTTTCATTTCACGAAATCGAGCATCCATCTAACTTTTTCAGTCCGGTGAAAAGCA
AACCATTCAAATTGAGCTCGAAAATTTATGAAAAATTACTTTAGAGGCACGTAGTTTTCGAACCCTTATAGAGTGCTCGACTACTTTCTTAGAATATGCCAATGTGCTTTTCTTTTCCAC
GACATGACGAAATTATAATATGCTTTTGTTTTGTACCAAAGAAAAACAATAGTCTATTCATATAAACTTTTTAGNACAAATTTCTTTTCTTGTTACACTGAAAAACCATTGGGTCCCTTT
CATAATGCCTGTCCTTTTCTCCCTCCTCCACATCAATAGCATGTACGGAAGTTTGATGCAACGGGTTAACAAGAAAGTCGACAACAAGCACCACCCAACGCTACTTTTTCCCGTCAAACC
ACTCAAAATTGCGATTAATTTTCGTCCATTTTATTATTTTCATTTTAGCAAATTGATAATGTCGCACGGTCATTTNATAATCACTTGCTATTCTTTGCAAAATTTTGAAATTTTNTGTAG

GCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTAGTGTCCAACACAATCTTCCTCAGCCTGGTTCCAAATTGGACCAGCTCAATTCTATG
TTCTCTTCTCATGGTCTCTCCCAAACTGACATGATCGCCTTATCAG
GTAATTAATTACATCTTATTATGAGATTTGGTGGATTACTAAGCAAATAGATCAAGAGACCACATAATTACTTG
CTAATCTCATATATATATTACTTAAGCATTTTGAACCCACAAAGCCATTCTTTTCGAAGAATTGTTTCTAAGCGTGACACAGAATTCTAAATTACAAAATNAATGCAGCATAAGCTCTAA
AAAATTTGTTATAATGTAATTTGCAAAATATACATGAAAGAGTAATTGGGTAAGCCGTCAAGTAAAGATGCATGACAACTTCCACTTTATGCAACACATCCTTGTCTATCATCTAATTAT
AATCATAGGAAGCGGAAGAAAAGTGTTCATAGGTACCCAATGGCTTCTTATTGGAGCAATGTGCTAGACAACTAGGCAAGCATTGTAGTCCACTTGATTACCTCTAGATTCATNTATATA
GCATGTCATAGCTCAGACGATTNTANTCTAATGTTTATCATAGTCCAATCATACTCTCTTTCATGATAGAATAGCATATGTAACTATTATGCCGGTAGTCATTGACANGTTCACAAAATT
ATTCAATTTCAAACGCTAAAGTTTGATTTTTCCCGGATAACTCACATCGTAACCACTGCGTTTGTAGGCGCGCACACGATTGGATTCTCTCANTGCGGCAAATTCTCCAAGCGGATCTAC
AACTTCAGCCCGAGAAGCTCGATCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTGAGGCAGATGTGCCCGATCAAGGTGGACCNCCGGATCGCCATCAACATGGACCCCACAACG
CCTCAGACGTTCGACAACGCCTACTACAAGAANCTCCAACAAGGAAAGGGCCTCTTCGTCTCCGACCAGACATTGTTCTCCGACCCGAGATCGAGGGCCACGGTCAACCTGTTCGCATCA
AACAACGCGGCGTTCCGACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGGGTCAAGACCGGGAACCAGGGTGAGATTAGGATTGATTGCACNCGCNCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTAAGTGCAGTCTCGGNTCAGCTCAGGACGGATTTCTACAAGAACNCGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCTGCAACTCTCCGCCTCTTGTTCCANGATTGCTTCGTCAGG
GGATGCGATGGTTCAGTGCTCATAGCGTCGCCC
ACCAACAACGCCGAGAAAGACCATCCCGATGACCTGTCGCTCGCCGGCGACGGCTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCT
TGTGCCGATATCTTGGCTCTTGCCGCTAGAGATGTCGTTTCGTTG
GCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTAGTGTCCAACAC
AATCTTCCTCAGCCTGGTTCCAAATTGGACCAGCTCAATTCTATGTTCTCTTCTCATGGTCTCTCCCAAACTGACATGATCGCCTTATCAG
GCGCGCACACGATTGGATTCTCTCANTGC
GGCAAATTCTCCAAGCGGATCTACAACTTCAGCCCGAGAAGCTCGATCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTGAGGCAGATGTGCCCGATCAAGGTGGACCNCCGGATC
GCCATCAACATGGACCCCACAACGCCTCAGACGTTCGACAACGCCTACTACAAGAANCTCCAACAAGGAAAGGGCCTCTTCGTCTCCGACCAGACATTGTTCTCCGACCCGAGATCGAGG
GCCACGGTCAACCTGTTCGCATCAAACAACGCGGCGTTCCGACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGGGTCAAGACCGGGAACCAGGGTGAGATTAGGATTGAT
TGCACNCGCNCCAAC

Retrieve as FASTA