Entry information : EguPrx68
Entry ID 11527
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-25 (Christophe Dunand)
Peroxidase information: EguPrx68
Name EguPrx68
Class Class III peroxidase    [Orthogroup: Prx019]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx68
start..stop
S start..stop
EgrPrx68 662 0 1..325 1..325
EglPrx68 662 0 1..325 1..325
EgrPrx67 658 0 1..325 1..325
EcamPrx67 650 0 1..325 1..325
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4759..4965 207 N° 2 4459..4656 198 N° 3 3708..3873 166 N° 4 2679..3082 404
complement(join(2679..3082,3708..3873,4459..4656,4759..4965))


exon

Literature and cross-references EguPrx68
Protein sequence: EguPrx68
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   325 (303)
PWM (Da):   %s   35207.84 (32842.6)  
PI (pH):   %s   9.13 (9.10) Peptide Signal:   %s   cut: 23 range:23-325
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEARRFLVSCLSFALLLSAVSAQLRTDFYKNTCPNVESLVRSAVTKKFQQTFVTAPATLRLLFHDCFVRGCDGSVLIASPTNNAEKDHPDDLSLAGDGFDTVIKAKAAVDSVPQCKNKVSCADXLALATRDVVSLAGGPFYSVELGRRDGRISTKLGVQHNLPQPGSKLDQLNSMFSSHGLSQTDMIALSGAHTIGFSHCGKFSKRIYNFSPRSSIDPTLNFGYALQLRQMCPINVDPRIAINMDPTTPQTFDNAYYKNLQQGKGLFVSDQTLFSDPRSRATVNLFASNNAAFQQAFVTAITKMGRIGVKTGNQGEIRIDCTRP

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_3_9393 (4965..2679)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTGAGTGCAGTCTCGGCTCAGCTCAGGACGGATTTCTACAAGAACACGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCCGCAACTCTCCGCCTCTTGTTCCACGATTGCTTCGTCAGG
GTTGGTTTTGAAACAAAGTAGTCTATACATAAT
AATGTTGGCTTGATTGTTAATTGTTTGCTTCTTTTTCTTTTTTTTTTTTCGTTTTGGGGATTTGATTAGGGGTGCGATGGTTCGGTGCTCATTGCCTCGCCCACCAACAATGCCGAGAAA
GACCATCCCGATGACCTGTCGCTCGCCGGCGACGGGTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCTTGTGCCGATATNTTGGCT
CTTGCCACTAGAGATGTCGTTTCGTTG
GTACGATAAGGACCCTCCACTAAACTCCTTTCCCAGTTTTTTCATTTCACGAAATCGAGCATCCATCTAACATTTTCAGTCCGGTGAAAAGCA
AACCATTCATATTGAGCTCGAAAATTTATGAAAAATTACTTTAGAGGCACGTAGTTTTCGAACCCTTATAGAGTGCTCGACTATTTTCTTAGAATATACCAATATGCTTTTCTTTTCCAC
GACATGACGAAATTATAATATGCTTTTGTTTTGTACGAAAGAANAATAATAGTCTAATCATATAAACTTTTTAGTACAAATTTCTTTTCTTGTTACACTGAAAAACCATTGGGTCCCTTT
CATAATGGCTGTCCTTTTCTCCCTCCTCCACATCAATAGCATGTATGGAAGTTTGATGCAACGGGTTATCAAGAAAGTCGACAACAAGCACTACAACAAGCACTACCCAACGCTACTTTT
TCCTGTCAAACCACTCAAAATTGCGATTGATTTTCGTCCATTTTATTCTTTTCATTTTAGCAAATTGATAATGTCGCGCGGTCATTTCATAATCACTTGCTATTCTTTGCAAAATTCTGA
AATTTTGTGTAGGCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTGGTGTCCAACACAATCTTCCTCAGCCTGGTTCCAAATTGGACCAG
CTCAATTCTATGTTCTCTTCTCATGGTCTCTCCCAAACTGACATGATCGCCTTATCAG
GTAATTAATTACATCTTATTATGAGATTTGGTGGATTACTAAGCAAATAGATCAAGAGGCCA
CGCAATTACATGCTAATCTCATATTATTATATATTACTTAAACATTTTGAACCCACAAAGCCATTCTTTTCGAAGAATTGTTTCTAAGCGTGACACAGAATTCTAAATTACAAAATTAAT
GCAGCATAAGCTCTAATTTTTTTTTTATAATGTAATTTGCAAAATATACATGAAAGAGTAATTGGGTAAGCCGTCAAGTAAAGATGCATGACAACTTCCACTTTNNNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNGGAAGCGGAAGAAAAGTGTTCATAGGTACCCAATGGCTTCTTATTGGAGCAATGTGCTAGACAACTAGGCAAGCATTGTAGTCCACTTGATTACCTA
AAGATTCCTTTATATAGCACATCATAGCTCAGATGATTGTAGTCTAATGTTTATCATAGTCCAATCATACTCTCTTTCATGATAGAATAGCATATGTACCTATTAAGCCGGTAGTCATTG
ACAGGTTCACAAAATTATTCAATTTCAAACGCTAAAGTTTGATTTTTCCCGGGTAACTCACATCGTAACCACTGCGTTTGTAGGCGCGCACACGATTGGATTCTCTCACTGCGGCAAATT
CTCCAAGCGGATCTACAACTTCAGCCCGAGAAGCTCGATCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTGAGGCAGATGTGCCCGATCAACGTGGACCCCCGGATCGCCATCAA
CATGGACCCCACAACGCCTCAGACGTTCGACAACGCCTACTACAAGAACCTCCAACAAGGAAAGGGCCTCTTCGTCTCCGACCAGACATTGTTCTCCGACCCGAGATCGAGGGCCACGGT
CAACCTGTTCGCATCAAACAACGCGGCGTTCCAACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGGGTCAAGACTGGGAACCAGGGCGAGATTAGGATTGATTGCACTCG
CCCCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGGCTCGTAGGTTTCTCGTGTCGTGCCTGAGCTTTGCCCTTCTGTTGAGTGCAGTCTCGGCTCAGCTCAGGACGGATTTCTACAAGAACACGTGCCCGAACGTCGAGTCCCTCGTC
CGGTCGGCCGTGACCAAGAAGTTCCAGCAGACCTTCGTCACCGCCCCCGCAACTCTCCGCCTCTTGTTCCACGATTGCTTCGTCAGG
GGGTGCGATGGTTCGGTGCTCATTGCCTCGCCC
ACCAACAATGCCGAGAAAGACCATCCCGATGACCTGTCGCTCGCCGGCGACGGGTTCGACACTGTGATCAAAGCTAAGGCAGCAGTGGATAGTGTTCCTCAGTGCAAAAACAAAGTCTCT
TGTGCCGATATNTTGGCTCTTGCCACTAGAGATGTCGTTTCGTTG
GCAGGGGGGCCGTTCTATAGTGTTGAATTGGGGAGACGCGATGGAAGAATATCAACTAAACTTGGTGTCCAACAC
AATCTTCCTCAGCCTGGTTCCAAATTGGACCAGCTCAATTCTATGTTCTCTTCTCATGGTCTCTCCCAAACTGACATGATCGCCTTATCAG
GCGCGCACACGATTGGATTCTCTCACTGC
GGCAAATTCTCCAAGCGGATCTACAACTTCAGCCCGAGAAGCTCGATCGATCCGACCCTGAACTTCGGCTACGCCTTGCAGCTGAGGCAGATGTGCCCGATCAACGTGGACCCCCGGATC
GCCATCAACATGGACCCCACAACGCCTCAGACGTTCGACAACGCCTACTACAAGAACCTCCAACAAGGAAAGGGCCTCTTCGTCTCCGACCAGACATTGTTCTCCGACCCGAGATCGAGG
GCCACGGTCAACCTGTTCGCATCAAACAACGCGGCGTTCCAACAGGCCTTCGTCACTGCGATCACAAAGATGGGTCGGATCGGGGTCAAGACTGGGAACCAGGGCGAGATTAGGATTGAT
TGCACTCGCCCCAAC

Retrieve as FASTA