Entry information : EguPrx69
Entry ID 11528
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx69
Name EguPrx69
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx69
start..stop
S start..stop
EgrPrx69 679 0 1..351 1..351
EcamPrx69 669 0 1..351 1..354
EglPrx69 629 0 25..351 1..327
EgrPrx83 587 0 25..351 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1734..2030 297 N° 2 2411..2596 186 N° 3 2842..3007 166 N° 4 3456..3859 404
join(1734..2030,2411..2596,2842..3007,3456..3859)


exon

Literature and cross-references EguPrx69
Protein sequence: EguPrx69
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   351 (300)
PWM (Da):   %s   38109.65 (32242.5)  
PI (pH):   %s   8.83 (7.72) Peptide Signal:   %s   cut: 52 range:52-351
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLERLQPITKIKRQQSRSSWHKAMACPKLILSCLLLQLMFSFHVPKVAHGQGLEVGFYQKACPNAEAIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTNQSEKDAPQNHSLRGFQTIDRVKTALEKACPGIVSCADILALVARDVVVATGGVFYDVETGRRDGYVSILGEASNDLIPSXANITTLKVDFTKRGLSVKDLVVLSGGHTIGTSHCTAFSNRLYNFTGKGDTDPTLDSNYIARLKLSCKPNDQTTLVEMDPGSVRTFDIKYFNLIAKRRGLFTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETSGEVRKVCSKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns)..
scaffold_3_9967 (1734..3859)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTGGAACGTCTACAGCCAATCACTAAGATTAAGAGACAGCAATCGCGTTCTTCTTGGCACAAAGCAATGGCTTGTCCAAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATG
TTCTCGTTTCATGTCCCTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAAATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCTGTC
GCTCCGAGTCTCTCCGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTGAGG
GTAAGTAAGAGAGCAAGCTCACATGCTTCTCTTCCTACTATGCATCCGAAGTTTACCATTTTC
TAATTACATGATAATTTGCATGTAACTAATGTTCGGATTCTAAGATGAGTAGTAATTGGCAGAAAAAGAGGGTGAGAAGTTAGATCTTGGGCTTTCATCTGAAGGGTAAATGCATGGTAG
GGATGCATAGAGATTCACAAAATTGAATTGCCGGATAACAATTTGATAAAATGAAAAATGTGTGTTCGATCTAGTAATATCCTAATAAATGTTATTTGGCTCTCATCATCCTTCTCTTGA
TTCGTCTTTGGTTACGAACTATTGTCTTCATGGATTCGTGGTTGAATAAAATGCTTTGGTTCTGGGCTTTTCCACAGGGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAAT
CCGAGAAGGATGCCCCTCAGAATCACAGCCTTCGAGGTTTCCAAACGATAGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCCGGGATCGTTTCGTGTGCTGACATCTTGGCCCTTG
TCGCTAGAGACGTTGTCGTCGCG
GTGCGTGCATATTCATACATCACATCCTCTGTATTTTATTGTCAAATTTGAATCTTTGTTACATAAGTACGACGTTAGTAGAATTCTCAATTGTTGC
AAACAATCTGTGTTATCTCCTTGGAAAAACAAATATTAGCCACACGTATCATAGAGGATAAGCACCGACAATTTTTGTTAATGAGAAATGCATTTTTATATAGAATTTGGGTTTTNNTNT
TTTTTTCTTGTTTTTGTTGTCACTTTAGACTGGAGGAGTTTTCTATGACGTGGAAACCGGACGAAGAGATGGGTATGTTTCTATTTTGGGGGAGGCATCTAACGATTTAATACCGTCTAN
GGCCAACATTACTACTCTGAAAGTAGATTTTACAAAGAGAGGCCTCAGCGTGAAGGACCTTGTCGTCTTATCAG
GTAGCGCCTAATCTCCAGTTATTGCTTCACATGCTTTGTCAAATAT
TTTGGGGAAATTTTCGAAAAGATGTGCCAATGTCCGTACTTTGCTTAGACAACAAAAGTCAAGCTTAGCCATCTTCCCTTTCATTCTTCAGGTGGTCTGTAATTTTCCATGCACTCAGGC
AAAATGAAACGAAGTTACTTATGCAATTTTTTTTTTTTTGGTTGATAACCTCAAACCAATTTGGGCTAGGCCCTAGTGATCTCTAAACCCACGAATGAAAGCTCAAGAGGTGGAAGGTAT
TCCTTTGATCGGGGTACAATCTCTAAAAAGCGATAAGACATAAATTAATGGGGGAAAAAAACTGTAATTTGAGCACGAGATACATAAACAGAGTCACCAATACAGGGAGAAAACGTAATT
TGCAACGGTGGATCATGCTAATTCTGATTTGCTATTGAGTAGGTGGGCACACCATTGGAACATCACACTGCACTGCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACTG
ACCCCACGCTCGACTCCAACTACATAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGACCAAACCACTCTCGTCGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAGTACTTCA
ATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACCAAGGCATACCTTGACTTTCAAATCAAGACCGGTGGATCCACTTTCTTCAAGGACT
TTGGAGAGTCAATGGTGAAAATGGGTCGGATTGGCGTGCTCACCGAAACGTCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTGGAACGTCTACAGCCAATCACTAAGATTAAGAGACAGCAATCGCGTTCTTCTTGGCACAAAGCAATGGCTTGTCCAAAGCTCATCTTGTCTTGCTTGTTGCTTCAGTTGATG
TTCTCGTTTCATGTCCCTAAGGTCGCTCACGGTCAAGGTCTCGAAGTAGGGTTTTACCAGAAGGCATGCCCAAATGCAGAGGCAATCGTGAAGGAAGTCATCGGCCAAGTCATGTCTGTC
GCTCCGAGTCTCTCCGGCCCTCTCTTGAGGCTGCATTTTCATGATTGTTTCGTGAGG
GGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCAATCAATCCGAGAAGGATGCCCCTCAG
AATCACAGCCTTCGAGGTTTCCAAACGATAGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCCGGGATCGTTTCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTC
GCG
ACTGGAGGAGTTTTCTATGACGTGGAAACCGGACGAAGAGATGGGTATGTTTCTATTTTGGGGGAGGCATCTAACGATTTAATACCGTCTANGGCCAACATTACTACTCTGAAAGTA
GATTTTACAAAGAGAGGCCTCAGCGTGAAGGACCTTGTCGTCTTATCAG
GTGGGCACACCATTGGAACATCACACTGCACTGCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGC
GACACTGACCCCACGCTCGACTCCAACTACATAGCAAGATTGAAGCTCAGTTGCAAGCCGAATGACCAAACCACTCTCGTCGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAG
TACTTCAATCTCATCGCAAAGAGAAGAGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACCAAGGCATACCTTGACTTTCAAATCAAGACCGGTGGATCCACTTTCTTC
AAGGACTTTGGAGAGTCAATGGTGAAAATGGGTCGGATTGGCGTGCTCACCGAAACGTCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAAT

Retrieve as FASTA