Entry information : EguPrx70
Entry ID 11529
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx70
Name EguPrx70
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx70
start..stop
S start..stop
EgrPrx70 619 0 1..327 1..327
EglPrx70 603 0 1..327 1..327
EgrPrx83 591 0 1..327 1..327
EguPrx69 592 0 1..327 25..351
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 919..1143 225 N° 2 1403..1588 186 N° 3 1825..1990 166 N° 4 2548..2951 404
join(919..1143,1403..1588,1825..1990,2548..2951)


exon

Literature and cross-references EguPrx70
Protein sequence: EguPrx70
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35413.37 (32407.8)  
PI (pH):   %s   8.4 (8.56) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEVAQGQGLKVGFYRKACPNAEIIVKEVIGQVMSVAPSLSGPLLRLHFHDCFVRGCEGSVLLNSPTYQAEKDAHPNHSLRGFQTIDRVKTALEKACPGIVXCADILALVARDVVVATGGLLYDVETGRRDGNVSSMKEALNDLIPSKANITILKIDFAKRGLSVKDLVVLSGGHTIGTSHCPSFSNRLYNFTGKGDTDPTLDSNYLARLKLSCKPDDQTTLVEMDPGSVRTFDIKYFNLIAKRRGLFTSDAALLDDSQTKAYLDFQIKTGGSTFFKDFGESMVKMGRIGVLTETAGEVRKVCSKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_3_9970 (919..2951)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTTCTTGTCCCTGAGGTTGCTCAAGGTCAGGGTCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCA
AACGCAGAGATCATCGTGAAGGAAGTCATTGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTTTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
GTAAGTAAGAGAGCA
AGCTCCCATGCTCCTCTTCCTACTACGCGTTTGCAGTTTACCAGTTTCTTATGATTTGACTATTTGCATGCAACTAATGTTCGGAACCTAAGATGAGTAGTAACTGGCAAAAGAAGAGAG
GGTGAGAAGTTAGATCCTGGCTTTTATCTGAAGAGGTAATGCATGGTAGGGATGCATCGTTACGAACTGTTATCTTCATGAACTCACGGTTNAATATAATGCTTTATTCTGGGCTTTTCC
ACAGGGTTGTGAAGGTTCGGTACTATTGAACTCTCCGACCTATCAAGCCGAGAAGGACGCCCATCCAAATCACAGCCTTCGAGGTTTCCAAACGATTGATAGAGTCAAAACGGCATTGGA
GAAGGCATGCCCTGGCATCGTTNCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
GTGCGCGCATATTCATACATCACTGCCTCTATAGTTTCTTCTCAAATTTG
AATCTTTGTTACATAAGTACGACGTTAGTAGAATTCTCAATTTTCGCAAACGATCTGTGTTATCTCCTTGGAAAACAAATTGTAGCCACGCTTATCTTAGAGGATAAGCACCGACAATTT
TTATTAATGAGAAACACATTTTTATATAGAAATTGGGTTTTTTTTTTTTTTGTGTTGTTGCTTTAGACTGGAGGACTTCTCTATGATGTGGAAACCGGACGGAGAGATGGGAACGTTTCT
TCTATGAAGGAGGCGCTTAATGATTTGATACCATCTAAAGCCAACATTACAATTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCTATCAG
GTAACACC
TAATCTCTAATTATTGTTTCACATTGGTCCTATCAGGTAACACCTAATCTCTAATTATTGCTTCACATTCTTTGTCAAATATTTTGGGGAAATTTTTGAAAANATGTGCCTATTTCCATA
CTTTGCTTAGGTCAAAGTAACTCTAATTTGTCGAGACAGACTCATGGCTTGCACAGCACAAGTCAAGCTTAGCTGCCTTCCCTTTCATTTTTCGGATGGTCAGTAATTTTCCATGCACTC
AGACTGAACGAAACAAAGTGACTTAGACAATTTTNTNTTTTTTTCGATAACCTCTGACCAATCTGAGCCGGGCCTTTGCGATCTCTAAACCCACGGATGAAAGCTCAAGTGCNGGAAGGT
ATTCCTTCGATCGTGGTACGATCTCTAATGGGGAAAGCTCCCTCACCATGTATAAAAATAGATAAGACATAAATTAATAAGGGAAAAAACTGTTATTTGAGCGAGGGATACATAAACACA
TCACCTGTACAGGGAGAAAACGTAATTTGTAACTGTAGATCATGCTAATTTTGATCTGCTATTAACCAGGTGGGCACACAATTGGAACATCACACTGCCCTTCCTTCTCCAACCGCCTCT
ACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAAGCTCAGTTGCAAGCCGGATGACCAAACCACTCTCGTCGAGATGGACCCGGGAAGCG
TGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACGAAGGCGTACCTTGACTTCCAGATCAAGA
CCGGTGGATCCACTTTCTTCAAGGATTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGTGCTGACCGAAACGGCTGGTGAAGTCAGGAAAGTGTGTTCAAAGGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCAAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTTCTTGTCCCTGAGGTTGCTCAAGGTCAGGGTCTCAAAGTAGGGTTTTACCGGAAGGCATGCCCA
AACGCAGAGATCATCGTGAAGGAAGTCATTGGCCAAGTCATGTCCGTTGCTCCGAGTCTCTCTGGCCCTCTTTTGAGGCTGCATTTTCACGATTGTTTCGTTAGG
GGTTGTGAAGGTTCG
GTACTATTGAACTCTCCGACCTATCAAGCCGAGAAGGACGCCCATCCAAATCACAGCCTTCGAGGTTTCCAAACGATTGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCTGGCATC
GTTNCGTGTGCTGACATCTTGGCCCTTGTCGCTAGAGACGTTGTCGTCGCG
ACTGGAGGACTTCTCTATGATGTGGAAACCGGACGGAGAGATGGGAACGTTTCTTCTATGAAGGAGGCG
CTTAATGATTTGATACCATCTAAAGCCAACATTACAATTCTGAAAATAGATTTTGCAAAGAGAGGCCTCAGTGTGAAGGATCTTGTCGTCCTATCAG
GTGGGCACACAATTGGAACATCA
CACTGCCCTTCCTTCTCCAACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCACGCTCGACTCCAACTACTTAGCCAGACTGAAGCTCAGTTGCAAGCCGGATGACCAAACC
ACTCTCGTCGAGATGGACCCGGGAAGCGTGAGGACGTTCGACATCAAGTACTTCAATCTCATTGCGAAGAGAAGGGGCCTCTTTACTTCGGACGCCGCACTTCTTGACGACAGCCAAACG
AAGGCGTACCTTGACTTCCAGATCAAGACCGGTGGATCCACTTTCTTCAAGGATTTTGGAGAGTCGATGGTGAAAATGGGTCGGATTGGCGTGCTGACCGAAACGGCTGGTGAAGTCAGG
AAAGTGTGTTCAAAGGTTAAT

Retrieve as FASTA