Entry information : EguPrx73
Entry ID 11531
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx73
Name EguPrx73
Class Class III peroxidase    [Orthogroup: Prx030]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx73
start..stop
S start..stop
EgrPrx73 652 0 1..326 1..326
EglPrx73 652 0 1..326 1..326
EcamPrx73 652 0 1..326 1..326
RcPrx44 504 0 5..326 7..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3401..3619 219 N° 2 2602..2781 180 N° 3 2349..2514 166 N° 4 1504..1916 413
complement(join(1504..1916,2349..2514,2602..2781,3401..3619))


exon

Literature and cross-references EguPrx73
Protein sequence: EguPrx73
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (300)
PWM (Da):   %s   34720.58 (31929.0) Transmb domain:   %s   i13-35o
PI (pH):   %s   6.14 (5.73) Peptide Signal:   %s   cut: 27 range:27-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
METRVFTLNRLIFLVIFLAXVVASSAQLSFGFYAASCPAAESIVRNTVRSASSSDPTIPGKLLRLLFHDCFVEGCDASVLIRGNGTEQNDPANTSLGGFSVIDSAKRVLELFCPGTVSCADIIALAARDAVELTGGPAVQIPTGRKDGRVSAASNVRPNIVDTSFTINEMIKLFSSKGLSLADLVALSGAHTIGAAHCSAFSDRFQADSKGKFTLIDSSLDKNYAEELMRRCPAGASPSITVNTDPETSLSFDNQYYRNLLLHKGLFQSDSXLVKDNRTREKVENFANDQDSFFASWAQSFLKLSVVEVKTGNAGEVRQSCSLIN

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_3_11388 (3619..1504)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACCAGAGTTTTCACTTTGAATCGTCTCATTTTTCTCGTCATCTTCCTAGCTCANGTGGTTGCCTCTTCCGCTCAGCTGTCTTTTGGCTTCTATGCTGCTTCATGTCCTGCTGCT
GAATCCATAGTCAGGAACACAGTGAGATCAGCTTCTTCCAGTGACCCCACAATCCCTGGGAAGCTCCTTCGATTACTCTTTCATGACTGCTTCGTGGAG
GTTNGTCTTCTTCTCTCCACT
GCTCACTTTAGGAAGAGACAGATTCTTGTAGTCTTGAAACTCGTGCAAAGAATGTACTTCATGCCTCCTAGTATCCAATGGACAGCTTCGCATAATGTTTCTACNGTGAACTTTATTGGG
TTCCTACGGACGGAAATTTTAGCCAAGTTTGACTTATGTTTATTGAATCTGTATAATTCCATTTTAGCCAAAGGAAATTTAAAGCTCAAGACANCGACTCAAATGTTCCTTTGCTTCTAG
TGTTTGGCCAAGGAAGAAGATCTCATGAACTTTATAGGAAGTCCTGAAGAAGTGAGAAATCTTTCTGAGGTCATAATGGATGAATTATCCGTGGAAACTGAGAAGATAGTGACAGTCATT
TCAAATACTACAGGCTTACTTTCTTCAAGCAATCTATGTTCCTGAATGCAAAGAGAAGTCTCTCCATTCATCATCGTGTATGAAATTATTCACTTGTAAATTTTCCTGTGTGCGGTCTTG
CTGACACTTCATGCTTCTCCTGAGTCTGTCTCCTAACTTAAGCCAAGAAGTTAGGCCTGTTTCTGAAGTGACTATAATTTCAANATCAATTTGACTGATTACTATGATATGGTAGTAGGG
TTGCGATGCATCCGTGCTTATACGAGGAAATGGAACAGAGCAAAATGATCCAGCTAATACATCACTTGGAGGATTTTCTGTCATAGACTCAGCTAAAAGGGTTTTAGAATTATTCTGTCC
AGGAACCGTTTCTTGCGCCGATATAATTGCATTAGCTGCCAGGGATGCTGTTGAACTG
GTAATGCAGATTCTCAATACTACCTTTTGCCTTTCCAAATTTTTTAGTACAAGGTTTTTNCA
CTGAATTATGCATGCTTCAATGCAGACTGGAGGGCCTGCAGTTCAGATTCCAACAGGTAGGAAAGATGGGAGAGTTTCTGCAGCTTCAAATGTAAGACCCAACATCGTGGATACAAGTTT
TACAATCAACGAGATGATTAAACTCTTCTCGTCTAAGGGGCTGTCCTTGGCTGATCTTGTCGCACTGTCAG
GTATAACTGGAATATATCAGCTCCTAAAAGCAAAACAAGGTCAAGAACA
GTTAGTAGTGCGGGCACCGTGTTCGGAAAATTTCCCTAAGNGTAGTTGTTAACAAAAATATTGATTTTTGGGTCATTTCTTTTCTAATGAAATAATAACGACAATGCANAGGACTTTTCT
CCTTATAGCTGGAATCACATGAACAAAATATTCCCAGGTACTTGCATTCCCCTGACCATCAGAAAAGGAAACGGATTCGAGTCAATGGGAAATTTTGGGATTGATGGGTCAACGAAAAAG
TTAGAATTGTGGATAACAAATCACTCAGGCAAATCCTAGTTGCTAGTTCATGAAATGGAGGAAGTAAGNTTTAGTTTTAAAGACNCGATCGTTGGAGCATCCATTGCCTACAGTTGGTAA
TATTATGTGCTTTGAGGTGACAGGTGCACATACCATAGGAGCGGCTCACTGCAGTGCATTCAGCGACAGATTCCAAGCTGACTCCAAGGGGAAGTTCACCCTAATTGACTCATCCCTCGA
CAAGAATTATGCAGAGGAACTCATGAGACGGTGCCCTGCAGGTGCTAGTCCATCCATTACAGTTAACACCGACCCTGAAACATCCTTGTCATTTGACAATCAGTACTACCGAAATCTCTT
GTTGCACAAGGGGCTATTTCAGTCAGATTCTNTACTGGTAAAGGATAACAGAACAAGGGAGAAAGTAGAGAATTTCGCGAATGACCAGGACAGTTTCTTTGCAAGCTGGGCTCAGTCATT
CTTGAAGCTCAGTGTAGTTGAAGTAAAAACAGGCAATGCGGGGGAGGTGAGACAATCTTGCTCACTTATTAACGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGACCAGAGTTTTCACTTTGAATCGTCTCATTTTTCTCGTCATCTTCCTAGCTCANGTGGTTGCCTCTTCCGCTCAGCTGTCTTTTGGCTTCTATGCTGCTTCATGTCCTGCTGCT
GAATCCATAGTCAGGAACACAGTGAGATCAGCTTCTTCCAGTGACCCCACAATCCCTGGGAAGCTCCTTCGATTACTCTTTCATGACTGCTTCGTGGAG
GGTTGCGATGCATCCGTGCTT
ATACGAGGAAATGGAACAGAGCAAAATGATCCAGCTAATACATCACTTGGAGGATTTTCTGTCATAGACTCAGCTAAAAGGGTTTTAGAATTATTCTGTCCAGGAACCGTTTCTTGCGCC
GATATAATTGCATTAGCTGCCAGGGATGCTGTTGAACTG
ACTGGAGGGCCTGCAGTTCAGATTCCAACAGGTAGGAAAGATGGGAGAGTTTCTGCAGCTTCAAATGTAAGACCCAACATC
GTGGATACAAGTTTTACAATCAACGAGATGATTAAACTCTTCTCGTCTAAGGGGCTGTCCTTGGCTGATCTTGTCGCACTGTCAG
GTGCACATACCATAGGAGCGGCTCACTGCAGTGCA
TTCAGCGACAGATTCCAAGCTGACTCCAAGGGGAAGTTCACCCTAATTGACTCATCCCTCGACAAGAATTATGCAGAGGAACTCATGAGACGGTGCCCTGCAGGTGCTAGTCCATCCATT
ACAGTTAACACCGACCCTGAAACATCCTTGTCATTTGACAATCAGTACTACCGAAATCTCTTGTTGCACAAGGGGCTATTTCAGTCAGATTCTNTACTGGTAAAGGATAACAGAACAAGG
GAGAAAGTAGAGAATTTCGCGAATGACCAGGACAGTTTCTTTGCAAGCTGGGCTCAGTCATTCTTGAAGCTCAGTGTAGTTGAAGTAAAAACAGGCAATGCGGGGGAGGTGAGACAATCT
TGCTCACTTATTAACGGG

Retrieve as FASTA