Entry information : EguPrx82
Entry ID 11536
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx82
Name EguPrx82
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx82
start..stop
S start..stop
EglPrx82 652 0 1..327 1..327
EgrPrx82 651 0 1..327 1..327
EgrPrx88 651 0 1..327 1..327
EcamPrx82 616 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3534..3758 225 N° 2 4020..4205 186 N° 3 4478..4643 166 N° 4 4821..5224 404
join(3534..3758,4020..4205,4478..4643,4821..5224)


exon

Literature and cross-references EguPrx82
Protein sequence: EguPrx82
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   34605.85 (31752.3)  
PI (pH):   %s   8.69 (8.89) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLVQLMFLXLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVXGQVMSVAPSLSGPLLRMHFXDCFVRGCEGSILLNSSTNQAEKDXPPNFSLRGYQVIDRVKTALEKACPGIVSCADVLAIVARDVIVATRGLSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMRGLSVKDLVVLSGGHTLGTSHCSSFSXRLYNFTGKGDTDPXLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDSALLDDSQTKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_5_18730 (3534..5224)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGNTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATNGGTCAAGTCATGTCNGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCANGACTGTTTCGTNAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTTGTGCTTGGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAAAGAATGGTTTTTACTTTCGTCGAACCATCTGCTAAACATCAATTAGA
ACAAGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACNTACTTTTCTAGATTCGTCCGTGGATACGAACTGTTTTCTGCGTGAACTCACAGTTGAATAGTGTTTCTTTCTGGGTTTTT
CCACAGGGTTGCGAAGGTTCAATACTCTTGAACTCTTCNACCAATCAAGCCGAGAAGGACGNGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCATCGTTTCGTGTGCTGACGTTTTGGCCATCGTNGCAAGAGATGTCATCGTCGCG
GTNCGCATATGCATATGTCACATGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCTGTAGAAATCTCGATTTTCACANACAATCCATGCTCTCTCGTTGGAAAAAATACTCNNCCCATACTTATCTTCGGATCTAATTANTGCTTGTCAA
AACCGAGATTATTTTTTCNTCGTGCATCATAAAACTCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGGAATTGAGTTTCTTTTTGTTGTCACTTTAGACCAGAGGCCTNTCCT
ATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCC
TCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAACACCTAATCTTCAATNATTGCTTCANATGCTTTATCAATTATTTTGTGGAAATTGACATAAATTAATAGGAAGAACTATAATTTGA
GCACGAGATTCATAAACAGTCTGCACTGCGAGGAGAAAACGTAATTTGTAAAGTTAGATCATGCTAATTCTGATTTCTATTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCNT
CCTTCTCCNACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCNAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTCGTCG
AGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACTCTGCACTTCTTGATGATAGCCAAACCAAGGCATACA
TTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGTGTGCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTG
CAAAGGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGGTTCAGTTGATGTTCTTGNTCCTTGTCCCTGAGGTCGCTCACGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATNGGTCAAGTCATGTCNGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCANGACTGTTTCGTNAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCNACCAATCAAGCCGAGAAGGACGNGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCATC
GTTTCGTGTGCTGACGTTTTGGCCATCGTNGCAAGAGATGTCATCGTCGCG
ACCAGAGGCCTNTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAATGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACCCTGAAAGCAGATTTTGCAATGAGAGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCNTCCTTCTCCNACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCNAGCTCGACTCTAACTACATAGCAAGACTAAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTCGTCGAGATGGACCCAGGAAGCGTGAGGACTTTCGACATCAAGTACTTCGATCTGATCCCGAAGAGAAGAGGCCTCTTCACTTCGGACTCTGCACTTCTTGATGATAGCCAAACC
AAGGCATACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGTGTGCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAAC

Retrieve as FASTA