Entry information : EguPrx83
Entry ID 11537
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx83
Name EguPrx83
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx83
start..stop
S start..stop
EglPrx87 655 0 1..327 1..327
EgrPrx87 655 0 1..327 1..327
EcamPrx87 647 0 1..327 1..327
EgrPrx83 639 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2663..2887 225 N° 2 3288..3473 186 N° 3 3751..3916 166 N° 4 4098..4501 404
join(2663..2887,3288..3473,3751..3916,4098..4501)


exon

Literature and cross-references EguPrx83
Protein sequence: EguPrx83
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   34735.95 (31775.4)  
PI (pH):   %s   8.15 (8.28) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACSKLFLSCLLVQLTFLFLVPEVAHGQGLKVGFYQKACPNAEAIVKGVIHEVMSVAPSLSGPLLRMHFHDCFVRGCEGSVLLNSPTNQSEKNAGPNLSLRGFQTIDRVKTALEKACPGIVSCADIVALVARDVVVATGALSYDVETGRRDGNVSILTDALNXLIPPXANITTLKADFAKKGLSVKDLVVLSGGHTIGTSHXSSFSDRVYNFTGKGDADPTLDSNYIARLKLRCKPNDQTTLVEMDPGSVRTFDVKYFDLIPKRRGLFTSDSALLDDSETKAYIDLQIKTGGSTFFKDFGESMVNMGRIGVLTGTAGEVRKVCTKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_5_19143 (2663..4501)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GTAAGTAAGAGAGCG
AGCTCACATGATTCTCGTCCTACCACAAGTGTAACTCGTCCTACTACGAGTGTAAAGTTTACCATTTTCTAATTACGTGATTCCTTGCATGTAACTAATGTTCGGATTCTAAGGTGGAAA
ACTTACTGGCGAAAAACGAGCGTGAGAATTTAGATCTTGGGCTTTCATCTGAAGGGGTAATGCATGGAAGGAATGCATAGAGATTTACAAGATTGATTTACTGGATAACAATATGATAAA
ATGGAAAATGTGTATTAGAACTAGTTATGTACTAGTAAATGGTGTTTGGCTCCTCAACATACTTCTCTAGATTCGTCCTTGGTTACGAACTACTGTCTTCATGACCTCGCGGTTGAATCA
TCTTTTGTTCTGGGCCTCTNCACAGGGCTGCGAAGGTTCAGTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGA
TAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATCGTCTCATGTGCTGACATTGTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
GTGAGCATATGCATACATTACCTCCTTTA
TTTTTTGTTTNAAATTTGGATGTTTGTTATATAATTAGGACGTTAGTAGAAATCTTGATTTCACAAACGATCTGTGTTATCTCATTTGAAAACGAATTNTAGCCATACATATTATGGAAT
CCAAGTATCGCTTGTTGATATTAAGATTATTTTTACGGCGCTCTTGACAAAACACGACTATTTTATATTTTAATGAGAAAAACATTCTTATATAGATTTTTTTTTTTTTTTTTGGCGTTG
TCTTTTAGACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCTTGACCGACGCACTTAACAANTTAATACCACCTNCGGCCAACATTACAACTCTGA
AAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGTCCTGTCAG
GTAACACCTAATCTCCAATTATTGCTCCATATGCTTTGTCAATTATTTTATGGGGATTGACATAAA
TTAATCGGGAAGAAATTGTAATTTGAGTGCGAGATCATAAACATCGTCAGCACTACAACGATAGAACATAATTTGTGTANTTAGATCATGCTAATTCTGATTTCCAATTGACCAGGTGGG
CACACCATTGGAACTTCACACTGNTCTTCCTTCTCCGACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGC
AAGCCGAATGATCAAACCACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTT
CTTGATGACAGCGAAACCAAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGA
ACGGCGGGCGAAGTCAGAAAAGTGTGCACAAAGGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTTCAAAGCTCTTCTTGTCTTGCTTGTTGGTTCAGTTGACGTTCTTGTTTCTTGTTCCTGAGGTCGCTCATGGTCAAGGTCTCAAAGTAGGGTTTTACCAGAAGGCATGCCCA
AACGCAGAGGCCATCGTGAAGGGGGTCATCCATGAAGTCATGTCCGTCGCTCCGAGTCTCTCTGGCCCTCTCTTGAGGATGCATTTTCATGATTGTTTCGTTAGG
GGCTGCGAAGGTTCA
GTACTATTGAACTCTCCGACCAATCAATCCGAAAAGAATGCGGGTCCCAATCTCAGTCTTCGAGGTTTCCAAACGATCGATAGAGTCAAAACGGCATTGGAGAAGGCATGCCCGGGCATC
GTCTCATGTGCTGACATTGTGGCCCTCGTCGCTAGAGACGTGGTCGTCGCG
ACTGGAGCACTTTCCTATGATGTGGAAACCGGACGAAGAGACGGGAACGTGTCTATCTTGACCGACGCA
CTTAACAANTTAATACCACCTNCGGCCAACATTACAACTCTGAAAGCAGATTTTGCAAAGAAAGGCCTCAGTGTGAAGGACCTTGTCGTCCTGTCAG
GTGGGCACACCATTGGAACTTCA
CACTGNTCTTCCTTCTCCGACCGCGTCTACAACTTTACCGGAAAGGGCGATGCCGACCCCACCCTTGACTCCAACTACATAGCGAGATTGAAGCTCAGGTGCAAGCCGAATGATCAAACC
ACCCTTGTCGAGATGGACCCGGGAAGTGTGAGGACGTTCGACGTCAAGTACTTCGACCTCATCCCGAAGAGAAGAGGCCTCTTCACTTCAGACTCCGCACTTCTTGATGACAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGAGTCGATGGTGAATATGGGTCGGATTGGCGTGCTCACTGGAACGGCGGGCGAAGTCAGA
AAAGTGTGCACAAAGGTCAAT

Retrieve as FASTA