Entry information : EguPrx84
Entry ID 11538
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-15 (Christophe Dunand)
Peroxidase information: EguPrx84
Name EguPrx84
Class Class III peroxidase    [Orthogroup: Prx011]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx84
start..stop
S start..stop
EguPrx88 670 0 1..327 1..327
EgrPrx84 670 0 1..327 1..327
EcamPrx84 667 0 1..327 1..327
EgrPrx82 653 0 1..327 1..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4993..5217 225 N° 2 4546..4731 186 N° 3 4108..4273 166 N° 4 3529..3932 404
complement(join(3529..3932,4108..4273,4546..4731,4993..5217))


exon

Literature and cross-references EguPrx84
Protein sequence: EguPrx84
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   327 (300)
PWM (Da):   %s   35253.07 (32238.5)  
PI (pH):   %s   8.25 (8.38) Peptide Signal:   %s   cut: 28 range:28-327
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACPKLFLSCLLLQLMFLFLVPEVAHGQGLKVGFYQKTCPNAEAIVKKVMDQVMSVAPSLSGPLLRMHFHDCFVRGCEGSILLNSSTNQAEKDAPPNFSLRGYQVIDRVKTALEKACPGTVSCADVLAIVARDVVVATGALSYDVETGRRDGNVSSLNEALNNLVPPNANITTLKADFAMKGLSVKDLVVLSGGHTLGTSHCSSFSDRLYNFTGKGDTDPKLDSNYIARLKLKCKPNDQTTLVEMDPGSVRTFDIKYFDLIPKRRGLFTSDAALLDDSETKAYIDLQIKTGGSTFFKDFGVSMVNMGRIGVLTGTAGEVRKVCAKV

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_5_18743 (5217..3529)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTCGCCCCGAGTCTCTCTGGCCCTCTCCTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GTAAGTGAATGAATG
AGCGCACGTACTTCTCTTCCTACTTGTGATTGGGAAGAGTACTATCTTATGAGCACCTGTATAATGACTGAAGAGAATGGTTTTTACTTTCGTCGAACCATCTGCTAAACATCAATTAGA
ACAAGTTATAATCTAACGAATGGTGTTTAGCCCCTCAACATACTTTNCTAGATTCNTCCGTGGATACGAACTGTTTTCTGCATGAACTCACAGTCGAATAGTGTTTCTTTCTGGGTTTTT
CCACAGGGTTGCGAAGGTTCAATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTG
GAGAAGGCATGTCCCGGCACCGTTTCNTGTGCTGACGTNTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
GTGCGCATATGCATATGTCACTTGCATTATTTATTCATTCTAATTTTA
ATGTTCCTCATTTACATATGACATCAGTAGAAATCTCGATTTTCACAAACAATCCATCCTCTCTCATTGGAAAAAAAATTCCGCCCATACGTATCTTCGGATCTAATTACTGCTTGTCAA
AACCGAGATTATTTTCACATCGTGCATCATAAAACTCAATGATTTTTCCATAAGAGAAAAACATATTTATATAGGAATTGGGTTTCTTTTTGTTGTCACTTTAGACCGGAGCACTTTCCT
ATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAACGAGGCGCTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAAGGGCC
TCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTAACACTTAATCTTCAATTGCTTCATATGCTTTATCGATTATTTTGTGGAAATTGACATAGATTAATAGGAAGAAACTATAATTTGAGC
ACGAGATTCATAAACAGTCTGCACTGCAAGGAGAAAACGTAATTTGTAAAGTCAGATCATGCTAATTCTGATTTCTATTGACCAGGTGGCCACACCCTTGGAACTTCACACTGCTCTTCC
TTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGATTGAAGCTCAAGTGCAAGCCGAATGACCAAACCACCCTCGTNGAG
ATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAATACTTCGATCTGATCCCGAAGAGAAGAGGACTCTTCACTTCGGACGCCGCACTTCTTGATGATAGCGAAACCAAGGCGTACATT
GACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGGAAAGTGTGTGCA
AAGGTTAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTCCGAAGCTCTTCTTGTCTTGTTTGTTGCTTCAGTTGATGTTCTTGTTCCTTGTCCCTGAGGTCGCTCATGGTCAGGGTCTCAAAGTAGGGTTTTACCAGAAGACATGCCCA
AATGCAGAGGCCATCGTGAAGAAGGTCATGGATCAAGTCATGTCCGTCGCCCCGAGTCTCTCTGGCCCTCTCCTGAGGATGCATTTTCACGACTGTTTCGTTAGG
GGTTGCGAAGGTTCA
ATACTCTTGAACTCTTCGACCAATCAAGCCGAGAAGGACGCGCCACCGAATTTCAGCCTTCGCGGTTACCAGGTGATCGATAGAGTCAAAACGGCGTTGGAGAAGGCATGTCCCGGCACC
GTTTCNTGTGCTGACGTNTTGGCCATCGTCGCAAGAGATGTCGTCGTCGCG
ACCGGAGCACTTTCCTATGATGTGGAAACTGGACGAAGAGATGGGAACGTCTCTAGTTTAAACGAGGCG
CTTAACAACTTAGTACCACCTAATGCCAACATTACAACTCTGAAAGCAGATTTTGCAATGAAGGGCCTCAGTGTGAAGGACCTTGTCGTCCTATCAG
GTGGCCACACCCTTGGAACTTCA
CACTGCTCTTCCTTCTCCGACCGCCTCTACAACTTCACCGGAAAGGGCGACACCGACCCCAAGCTCGACTCTAACTACATAGCAAGATTGAAGCTCAAGTGCAAGCCGAATGACCAAACC
ACCCTCGTNGAGATGGACCCAGGAAGCGTGAGGACGTTCGACATCAAATACTTCGATCTGATCCCGAAGAGAAGAGGACTCTTCACTTCGGACGCCGCACTTCTTGATGATAGCGAAACC
AAGGCGTACATTGACCTCCAGATCAAGACCGGTGGATCCACCTTCTTCAAGGACTTTGGAGTGTCAATGGTGAACATGGGTCGGATCGGCGTGCTCACCGGAACGGCTGGTGAAGTCAGG
AAAGTGTGTGCAAAGGTTAAC

Retrieve as FASTA