Entry information : EguPrx85
Entry ID 11539
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx85
Name EguPrx85
Class Class III peroxidase    [Orthogroup: Prx039]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx85
start..stop
S start..stop
EgrPrx85 643 0 1..319 1..319
EglPrx85 640 0 1..319 1..319
EcamPrx85 639 0 1..319 1..319
GmPrx324 426 3e-151 20..319 24..327
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2112..2321 210 N° 2 1307..1658 352 N° 3 516..910 395  
complement(join(516..910,1307..1658,2112..2321))


exon

Literature and cross-references EguPrx85
Protein sequence: EguPrx85
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   319 (296)
PWM (Da):   %s   34349.34 (32145.3)  
PI (pH):   %s   6.5 (6.50) Peptide Signal:   %s   cut: 24 range:24-319
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGRAQCIGMGALLMAVWXGVSDGQLAYDYYKTTCPNAEDIVRREMLSFAFLDATAPAAFLRLMFHDCQVQGCDASILLDPIGXKSEIKSSRNFGIRKLDAIEYVKSALEXECPGQVSCADIIALAARESVALSGGPHIAIPLGRKDSRASNYQQADAHLPSPSISVDAFLHIFMXKGLNXEESVAILGAHTLGAGHCLNIIDRLYNPKPDDLMNPVFEARLRLQCPTLNPLMNLTATSNDITPTIFDNQYYRDILLGKGLFFIDSSISRDPRTSDIVKQFAIDQDYFFQAFSSAFVKLSSANTLSKTKGEVRKQCSRV

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
scaffold_5_19008 (2321..516)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGGCTCAGTGCATAGGAATGGGAGCATTATTGATGGCTGTGTGGNTTGGGGTGAGTGATGGTCAGCTGGCTTATGATTACTACAAGACAACATGTCCAAATGCTGAGGACATT
GTCAGGAGGGAGATGCTGAGCTTTGCTTTCTTGGATGCAACTGCACCCGCTGCCTTCCTCAGGCTCATGTTTCACGACTGCCAAGTTCAG
GTAATCATCACTTCATACACACAACCGCTC
CATCATTTCCTCAATCATTCCTCAATCATGCATGGTGTCATGTTGTGTCTGTGTATCCTCTGAAGAGAGAGAGAGAGAGAGANGTACATAAATGCATGAAAGTTAGACTGCACTCCCTAC
CTACATTGATCTCAGAATATACAAAGAGATTTTCTTACCATAACTAACATATTCCACAGTTATAGCATTCGGCTTCTCAATTGAATACATCCCATTTTTACAACTCCCATTTCCTGGAAT
GTTACACATTATGGTAAAACACCTTTGAAAACATGTTTTTCGAGTTGGTGTTGCACTGAGAGTTCTTTTTTTCTCTCTCTAGGGAGATACTGAGAGTGCATTATCCTTTGTTTAGTTGAT
AATATCTCGAGCTTGTTGCTTTCTTCCATAACTACATGATAACTATACTTCTCATTTTTTTAGGGATGTGATGCTTCGATACTTCTCGACCCNATTGGCTNGAAGTCGGAGATAAAATCG
TCCAGGAACTTCGGCATCAGGAAACTCGATGCGATCGAGTATGTCAAGTCGGCATTGGAANCCGAATGCCCGGGCCAGGTATCTTGTGCAGACATAATTGCACTAGCTGCAAGAGAATCG
GTGGCTCTGAGTGGAGGACCACACATTGCCATTCCTCTTGGAAGGAAAGACTCGAGAGCTAGTAATTACCAGCAAGCCGATGCTCATCTCCCTTCTCCAAGTATTTCTGTNGATGCATTC
CTNCATATCTTCATGNCTAAAGGGCTGAATCNNGAGGAATCAGTCGCGATCTTGG
GTAAGAATCACGTATCATTAATCTCGATATTGATCAACAAAACATATCGGCAGAACTTGTCCTAA
TCAGTGGCATTAATGAATCTATATGTGAATAAACTAANCCTGATAGACNCTTCAAAAGGAGATCCTGGCGATCACGGCTAGTNCAGTATCAGAGTACGGTTTTTGCATTAGNTAATGTGA
TACCAACGTACCTGTTTTGCGACATACTTGTTCATAGAAGTAGAACTCGATAGCGATTGTATGTAGATAATATTTTGCACATTAAAGATCGACCGATCCTTTTTGTTTTGTAACATGAAT
TTCAGCTGCTATAACCATTTAGAATGAATCAAGACTAGTGCTGATCCGTACTAANAAGTACGGACACTGCCGTGTGAACCGCTCTTTGCAGGTGCACATACACTAGGCGCCGGACACTGC
CTGAACATCATCGACAGATTGTACAACCCGAAACCCGACGATCTAATGAACCCAGTGTTCGAAGCTCGGCTCAGACTACAATGCCCAACTCTAAATCCCCTAATGAATCTCACAGCCACA
TCCAACGACATAACCCCAACAATATTCGATAACCAGTACTACAGGGACATCTTGTTGGGCAAGGGCTTGTTTTTCATCGACTCAAGCATCTCAAGAGATCCTCGCACTTCTGACATCGTC
AAGCAATTCGCCATTGATCAGGACTACTTCTTTCAAGCATTCTCTTCAGCATTCGTCAAGCTCTCTTCAGCCAACACCCTCAGCAAGACGAAGGGCGAAGTGCGGAAGCAATGCAGCAGG
GTGAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGAGGGCTCAGTGCATAGGAATGGGAGCATTATTGATGGCTGTGTGGNTTGGGGTGAGTGATGGTCAGCTGGCTTATGATTACTACAAGACAACATGTCCAAATGCTGAGGACATT
GTCAGGAGGGAGATGCTGAGCTTTGCTTTCTTGGATGCAACTGCACCCGCTGCCTTCCTCAGGCTCATGTTTCACGACTGCCAAGTTCAG
GGATGTGATGCTTCGATACTTCTCGACCCN
ATTGGCTNGAAGTCGGAGATAAAATCGTCCAGGAACTTCGGCATCAGGAAACTCGATGCGATCGAGTATGTCAAGTCGGCATTGGAANCCGAATGCCCGGGCCAGGTATCTTGTGCAGAC
ATAATTGCACTAGCTGCAAGAGAATCGGTGGCTCTGAGTGGAGGACCACACATTGCCATTCCTCTTGGAAGGAAAGACTCGAGAGCTAGTAATTACCAGCAAGCCGATGCTCATCTCCCT
TCTCCAAGTATTTCTGTNGATGCATTCCTNCATATCTTCATGNCTAAAGGGCTGAATCNNGAGGAATCAGTCGCGATCTTGG
GTGCACATACACTAGGCGCCGGACACTGCCTGAACATC
ATCGACAGATTGTACAACCCGAAACCCGACGATCTAATGAACCCAGTGTTCGAAGCTCGGCTCAGACTACAATGCCCAACTCTAAATCCCCTAATGAATCTCACAGCCACATCCAACGAC
ATAACCCCAACAATATTCGATAACCAGTACTACAGGGACATCTTGTTGGGCAAGGGCTTGTTTTTCATCGACTCAAGCATCTCAAGAGATCCTCGCACTTCTGACATCGTCAAGCAATTC
GCCATTGATCAGGACTACTTCTTTCAAGCATTCTCTTCAGCATTCGTCAAGCTCTCTTCAGCCAACACCCTCAGCAAGACGAAGGGCGAAGTGCGGAAGCAATGCAGCAGGGTGAAC

Retrieve as FASTA