Entry information : EguPrx86
Entry ID 11540
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx86
Name EguPrx86
Class Class III peroxidase    [Orthogroup: Prx008]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx86
start..stop
S start..stop
EglPrx86 688 0 1..337 1..337
EgrPrx86 687 0 1..337 1..337
EcamPrx86 630 0 27..337 3..313
PtrePrx01 589 0 1..337 1..331
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 654..902 249 N° 2 1090..1278 189 N° 3 1882..2047 166 N° 4 2197..2603 407
join(654..902,1090..1278,1882..2047,2197..2603)


exon

Literature and cross-references EguPrx86
Protein sequence: EguPrx86
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   337 (311)
PWM (Da):   %s   37297.04 (34326.6) Transmb domain:   %s   i7-26o
PI (pH):   %s   7.78 (7.50) Peptide Signal:   %s   cut: 27 range:27-337
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGFRALFFFAAIFFSFSTTIIYSAYAEGEGEAEVGSGLVIDFYKDTCPQAEDIIKEQVKLLYKRHKNTAFSWLRNIFHDCAVQSCDASLLLDSTRRDLSEKETDRSFGXRNFRYLDTIKEAVERECPGVVSCADILVLSARDGVVALGGPQIPLKTGRRDGRRSRADVIEEHLPDHNESMSVVLERFAKMGIDTPGVVALLGAHSVGRTHCVKLVQRLYPEVDPALNPDHVEHMLYKCPDXIPDPKAVQXVRNDRGTPMIFDNNXYRNILDNKGLLLVDHQLAVDKRTKPXVKKMAKSQNYFFKEFARALTTLSENNPLTGDKGEIRRQCNVANKH

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_5_19072 (654..2603)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGAGCTCTCTTCTTCTTTGCTGCCATCTTCTTCTCCTTCTCAACCACAATCATCTACTCTGCTTATGCAGAGGGTGAGGGTGAGGCTGAGGTAGGGTCTGGCCTGGTGATA
GACTTCTACAAGGACACTTGTCCTCAGGCTGAGGACATCATTAAAGAGCAAGTCAAGCTTCTCTACAAGCGCCACAAGAACACTGCATTCTCTTGGCTTAGGAACATCTTCCATGACTGT
GCTGTTCAA
GTGAGCTAGCTTTCCTTCCATTTGCTTATCTGTCTTTTCTTTTCGTTTTTCTTTCCAAGAATTTAAGTTAAAGGTGTTGCAGTCTTGTTCATCTTTCTTTGCCNTTTTCTT
TTTACCCAAAGAAATGCTGCCTTCTGAAGCTAAAGTTTTGATCTTTTCACTGTTTGGGCATGTGGGTGTTGCACAGTCTTGCGATGCTTCATTGCTCCTGGACTCAACGAGGAGGGATCT
CTCTGAGAAAGAGACGGACAGGAGCTTTGGGNTGAGGAACTTCAGGTACCTTGACACCATCAAGGAGGCTGTGGAGAGAGAATGTCCTGGAGTTGTTTCTTGTGCAGACATTCTGGTGTT
GTCTGCTAGAGATGGCGTTGTTGCG
GTACTTATGAATCTTTCACCCTCCAGATTATCAATTTTCCNCTCTGCATGCGGNGCTCGTGTCATTTCCTAGACTGTATCTGTTTCACAGATGCG
ACTTATAAAAAGATTTTCAAATGGGTCTAGTTCATGACATTCTATGATCTTTTGCTGACTCTGTAAAAAAGAAAGAAAGACAATAGTAGATATTTCAAGAATACTTTTCTGGGAAGAAAA
TCTAGTTGTGATTGATCCCTTCCAGTTCCTACTTGGGGGAGGTATCATGCGAGCACTACCATGGATATGGCAAAAATTCCATTTTTGACCTTGATCTCAGTGCCCTTTTCTTGAATTAAA
TGCTCTTTTGACTCATAACTGCAANAACTATTTNATTTCTGGCCAAACAAGAAAACTATTACAGGATTTCCAGTTTCAGCTTTAGGGAGAATTTGATTATAAGAATCAAAAAGGACAGCT
GCATGAACTTCAGATCTTACTGATGAGGGTTTTACTGTTTAGAAAAAAATGGGAGGAAAAAGAAAATCAATGGGCNTTATTAAATCTAAGCAGATCTGGCATAAATCTGTTCTCTAAACT
TTAAAAGCTATATTCTTTTCCTCACCAGCTAGGAGGCCCTCAAATTCCTCTGAAAACTGGAAGAAGAGATGGCAGGAGGAGCAGAGCAGATGTCATTGAGGAACACTTGCCAGACCACAA
CGAGAGCATGTCTGTTGTGCTTGAAAGATTTGCAAAGATGGGCATTGATACTCCTGGAGTGGTTGCCTTGCTCG
GTACTTTCATTTGGTGCTTCTTGAATTAATTCTAAGCTTCTGACTA
GTGTCTGAATTAAAGCGTTCATACTCAATCCAAATCCATTCTCACTCGAGTCCGTTGCCTGCAATTGATGGAGTCTAACAATGTCTTATATTGCATCTAACAGGAGCACACAGCGTNGGC
CGAACCCACTGCGTCAAGCTGGTTCAGCGGCTATACCCAGAGGTTGACCCAGCCCTCAATCCCGACCATGTGGAGCACATGCTCTACAAGTGCCCGGACCNGATCCCTGACCCAAAGGCC
GTGCAGTANGTGAGGAACGACCGTGGCACCCCCATGATATTCGACAACAACTANTACAGGAACATATTGGACAACAAGGGCTTGCTCCTGGTGGATCACCAGCTAGCCGTNGATAAGAGG
ACCAAGCCCTNTGTGAAGAAGATGGCCAAGAGCCAAAACTACTTCTTCAAGGAATTCGCCAGAGCCCTCACCACCCTTTCTGAGAACAACCCGCTTACCGGAGACAAGGGTGAGATCAGG
AGGCAATGCAACGTTGCCAACAAACACCAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGTTTCAGAGCTCTCTTCTTCTTTGCTGCCATCTTCTTCTCCTTCTCAACCACAATCATCTACTCTGCTTATGCAGAGGGTGAGGGTGAGGCTGAGGTAGGGTCTGGCCTGGTGATA
GACTTCTACAAGGACACTTGTCCTCAGGCTGAGGACATCATTAAAGAGCAAGTCAAGCTTCTCTACAAGCGCCACAAGAACACTGCATTCTCTTGGCTTAGGAACATCTTCCATGACTGT
GCTGTTCAA
TCTTGCGATGCTTCATTGCTCCTGGACTCAACGAGGAGGGATCTCTCTGAGAAAGAGACGGACAGGAGCTTTGGGNTGAGGAACTTCAGGTACCTTGACACCATCAAGGAG
GCTGTGGAGAGAGAATGTCCTGGAGTTGTTTCTTGTGCAGACATTCTGGTGTTGTCTGCTAGAGATGGCGTTGTTGCG
CTAGGAGGCCCTCAAATTCCTCTGAAAACTGGAAGAAGAGAT
GGCAGGAGGAGCAGAGCAGATGTCATTGAGGAACACTTGCCAGACCACAACGAGAGCATGTCTGTTGTGCTTGAAAGATTTGCAAAGATGGGCATTGATACTCCTGGAGTGGTTGCCTTG
CTCG
GAGCACACAGCGTNGGCCGAACCCACTGCGTCAAGCTGGTTCAGCGGCTATACCCAGAGGTTGACCCAGCCCTCAATCCCGACCATGTGGAGCACATGCTCTACAAGTGCCCGGAC
CNGATCCCTGACCCAAAGGCCGTGCAGTANGTGAGGAACGACCGTGGCACCCCCATGATATTCGACAACAACTANTACAGGAACATATTGGACAACAAGGGCTTGCTCCTGGTGGATCAC
CAGCTAGCCGTNGATAAGAGGACCAAGCCCTNTGTGAAGAAGATGGCCAAGAGCCAAAACTACTTCTTCAAGGAATTCGCCAGAGCCCTCACCACCCTTTCTGAGAACAACCCGCTTACC
GGAGACAAGGGTGAGATCAGGAGGCAATGCAACGTTGCCAACAAACACCAC

Retrieve as FASTA