Entry information : EguPrx91
Entry ID 11544
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-01-22 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-01-22 (Achraf Jemmat)
Peroxidase information: EguPrx91
Name EguPrx91
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx91
start..stop
S start..stop
EcamPrx91 806 0 1..399 1..399
EglPrx91 805 0 1..399 1..399
EgrPrx91 793 0 1..393 1..393
PpePrx50 473 3e-168 66..395 8..344
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3368..3709 342 N° 2 3077..3274 198 N° 3 2569..2734 166 N° 4 1970..2463 494
complement(join(1970..2463,2569..2734,3077..3274,3368..3709))


exon

Literature and cross-references EguPrx91
Protein sequence: EguPrx91
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   400 (378)
PWM (Da):   %s   43568.5 (41125.2) Transmb domain:   %s   i5-22o
PI (pH):   %s   5.25 (5.25) Peptide Signal:   %s   cut: 22 range:22-399
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MPNSLNGWIVIFVLLVSFLVSFRNRKGSSADQRGRPFDPPFSLDPLSPVLLQRNDDGAAVDDEDPALGLQYDFYRNTCPAAEEIVRSSMSRIYSQHPDVAPAFLRLLFHDCFIRGCDASVLLDDSHGNRSHPXERQAIPNRTLKGFDRIDTIKQELEDHCPGVVSCADVLVLATREGILLAGGPFYPLFTGRRDSIQSYYADAMAEIPKPDDNVFRTLHLFGLRGFDERETVSLLGGHNIGKIGCEFILERLHNFLGTGQPDPTXSADFLSEMRRNCGDSQTSSNSSSGSPLLMESTSLTKSDLGLTYFPQLATSISSGSSFDTHYYQSLLRGRGLLYADQQLMADERTASVVRAYXSDDGSAFRLDFARAMMKMSSLGILSGSDGQIRKNCSFVANXN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_6_20611 (3709..1241)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACTCCCTGAACGGCTGGATCGTCATCTTCGTCCTCCTCGTCTCCTTCCTCGTCTCCTTCAGGAACCGCAAGGGCTCGAGCGCCGACCAGCGTGGGCGGCCCTTCGACCCTCCC
TTCTCTCTCGACCCCCTCTCGCCCGTCCTTCTCCAGCGGAACGACGACGGCGCCGCCGTTGACGATGAAGACCCCGCGCTCGGGCTCCAGTACGACTTCTACCGCAACACCTGCCCTGCT
GCGGAAGAAATCGTGAGGTCTTCCATGTCCAGGATCTACTCCCAACACCCCGACGTCGCCCCCGCGTTTCTCCGTCTCCTCTTCCACGACTGCTTCATCAGG
GTTCCTCCTCCTCCTCCT
TCTTCGTTTCTGCTTTGTGGGGTTCCTCGTTTAGGGGCTGATTGCCATTGGGTTTNGGTTATTTTCTCGAGTCAGGGTTGCGATGCTTCAGTTCTCCTGGACGATAGCCATGGAAACCGC
AGCCACCCCNTCGAAAGGCAGGCCATCCCCAACCGGACCCTCAAGGGTTTCGACAGGATCGATACCATCAAGCAGGAGCTTGAAGATCATTGCCCTGGGGTTGTTTCTTGTGCCGATGTT
CTCGTGCTCGCCACCCGGGAGGGCATCCTCCTG
GTACGCTCTTCTCTCGTTCCCCTCTTCCAATTTCAAGAAACTGTCCCGTCCCCTGTCATCACCATCCGTNCATGCGGATTTCGATGA
AATTTAGTATTCTCATATTGGCATTGAATTGGCGCCCTATGTGGAAAAGTTTAATAATGATTCTCGAAGTCAGCTTAGCATTTGGGAAGATTTCATCTACTCCACGTCTAGGAACTTCTT
TCCTCTGTGTTTCCAGGCTTGCAGCTGGACGACAGCTACTTGATTAGTTTGTTCGAGCTTCTTAAGAATCTCTGTTTCTGTTTCCTTTTAACTCCTTATCCTATTCACCTCGTCTTTTGA
TGTTCGAGTCCACAGGCTGGTGGCCCATTCTATCCCCTTTTCACTGGCAGGAGAGACAGTATTCAGTCCTATTATGCAGATGCAATGGCTGAAATTCCTAAGCCAGACGATAATGTCTTC
CGGACGCTCCACCTGTTTGGTCTCAGAGGTTTTGACGAGAGAGAAACAGTCAGTCTCTTAG
GTATTATNACTAAAGTCCATCCTTCTATCTTACTTTGTGNTCGAGTTNGTTTGAANTGT
GAGTGGATAACCAGGCACTGAATTGATTAATTCTGTTGATATGAAGGAGGTCACAATATCGGCAAGATCGGTTGTGAGTTCATCTTAGAACGCTTGCACAATTTCTTAGGGACAGGTCAG
CCAGACCCAACCATNTCTGCAGATTTTCTTAGTGAGATGAGACGCAACTGTGGAGACAGTCAGACCAGCAGCAATAGCAGCAGTGGCTCTCCACTGCTCATGGAATCAACGAGCCTTACT
AAGTCTGATTTGGGTTTGACATACTTCCCACAGTTAGCGACTTCAATTTCTTCCGGATCAAGCTTTGACACCCATTATTACCAGAGCTTGCTTAGAGGGAGAGGTCTTCTATATGCTGAT
CAGCAGTTAATGGCTGACGAGAGAACTGCAAGTGTCGTAAGGGCTTATGNCTCAGATGACGGATCAGCCTTCAGATTGGACTTTGCTCGTGCTATGATGAAAATGTCAAGTCTTGGTATA
TTGTCTGGATCAGATGGGCAGATCCGAAAAAATTGCTCGTTTGTCGCCAACGNCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCCCAACTCCCTGAACGGCTGGATCGTCATCTTCGTCCTCCTCGTCTCCTTCCTCGTCTCCTTCAGGAACCGCAAGGGCTCGAGCGCCGACCAGCGTGGGCGGCCCTTCGACCCTCCC
TTCTCTCTCGACCCCCTCTCGCCCGTCCTTCTCCAGCGGAACGACGACGGCGCCGCCGTTGACGATGAAGACCCCGCGCTCGGGCTCCAGTACGACTTCTACCGCAACACCTGCCCTGCT
GCGGAAGAAATCGTGAGGTCTTCCATGTCCAGGATCTACTCCCAACACCCCGACGTCGCCCCCGCGTTTCTCCGTCTCCTCTTCCACGACTGCTTCATCAGG
GGTTGCGATGCTTCAGTT
CTCCTGGACGATAGCCATGGAAACCGCAGCCACCCCNTCGAAAGGCAGGCCATCCCCAACCGGACCCTCAAGGGTTTCGACAGGATCGATACCATCAAGCAGGAGCTTGAAGATCATTGC
CCTGGGGTTGTTTCTTGTGCCGATGTTCTCGTGCTCGCCACCCGGGAGGGCATCCTCCTG
GCTGGTGGCCCATTCTATCCCCTTTTCACTGGCAGGAGAGACAGTATTCAGTCCTATTAT
GCAGATGCAATGGCTGAAATTCCTAAGCCAGACGATAATGTCTTCCGGACGCTCCACCTGTTTGGTCTCAGAGGTTTTGACGAGAGAGAAACAGTCAGTCTCTTAG
GAGGTCACAATATC
GGCAAGATCGGTTGTGAGTTCATCTTAGAACGCTTGCACAATTTCTTAGGGACAGGTCAGCCAGACCCAACCATNTCTGCAGATTTTCTTAGTGAGATGAGACGCAACTGTGGAGACAGT
CAGACCAGCAGCAATAGCAGCAGTGGCTCTCCACTGCTCATGGAATCAACGAGCCTTACTAAGTCTGATTTGGGTTTGACATACTTCCCACAGTTAGCGACTTCAATTTCTTCCGGATCA
AGCTTTGACACCCATTATTACCAGAGCTTGCTTAGAGGGAGAGGTCTTCTATATGCTGATCAGCAGTTAATGGCTGACGAGAGAACTGCAAGTGTCGTAAGGGCTTATGNCTCAGATGAC
GGATCAGCCTTCAGATTGGACTTTGCTCGTGCTATGATGAAAATGTCAAGTCTTGGTATATTGTCTGGATCAGATGGGCAGATCCGAAAAAATTGCTCGTTTGTCGCCAACGNCAATTGA

Retrieve as FASTA