Entry information : EguPrx92
Entry ID 11545
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrx92
Name EguPrx92
Class Class III peroxidase     [Orthogroup: Prx016]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx92
start..stop
S start..stop
EcamPrx92 561 0 1..272 1..272
EgrPrx92 558 0 1..272 1..272
EglPrx92 553 0 1..270 1..270
CpapPrx26 463 8e-167 4..272 9..277
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1259..1462 204 N° 2 817..1005 189 N° 3 513..675 163 N° 4 1..260 260
complement(join(1..260,513..675,817..1005,1259..1462))


exon

Literature and cross-references EguPrx92
Protein sequence: EguPrx92
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   272 (250)
PWM (Da):   %s   28748.37 (26496.1)  
PI (pH):   %s   6.85 (7.14) Peptide Signal:   %s   cut: 23 range:23-272
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLVALVSAFLILQILSPVDALSTNYYDHTCPQLEATVTAAVKQAMMNDKTVPAALLRMHFHDCFIRGCDGSVLLNSTGGNTAEKDGPPNISLHAFYVIDNAKKAVEALCPGVVSCADILALAARDAVALSGGPTWNVPKGRLDGRTSKASDTRQLPAPIFNISQLQQSFSQRGLSMEDLVALSGGHTLGFXHCSSFQNRIHNFSPTTDVDPSLSPSFAANLRNVCPLGNTAKNAGSTLDSTTTTFDNVYFKMLRQGQSIFSSDQALLTN

Retrieve as FASTA  
Remarks Partial sequence from genomic (3' end is missing).
scaffold_6_20748 (1462..1)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCTAGTTGCTCTCGTCTCTGCTTTTCTCATCCTTCAAATTCTCTCTCCTGTCGACGCACTAAGTACAAACTACTATGACCACACTTGCCCCCAGCTCGAGGCTACGGTCACG
GCTGCTGTCAAGCAAGCCATGATGAATGACAAAACTGTTCCGGCTGCACTCTTGAGGATGCACTTCCACGACTGCTTCATTAGA
GTATACCTATTTCTCTACCTCTCCTTCTTAACCTTG
GTCTTTCTTTCCATCTTTGTATAGTAAAACCTGCCCATACGGATTCCTGATTCGTATGGTTAGTTGGGTATNCCATCGATCCGGATTGATCCCCTTATTTAAGGCTCCATGTCATAAAAC
AATGTATTTTACTCCATTGATGATCACTTCCTCATGTATAGCTTAGGTTATATATGTGGACTTCTATGATGTATGTTGGCTTCTTTATGAAAAATAGGGGTGTGATGGTTCTGTTCTGCT
GAACTCAACGGGAGGCAACACAGCAGAGAAAGATGGGCCTCCCAATATCTCACTGCATGCCTTCTACGTTATCGACAATGCGAAGAAGGCAGTGGAAGCACTGTGCCCCGGTGTCGTCTC
CTGTGCAGACATCTTGGCTCTCGCTGCTCGCGATGCTGTTGCTCTG
GTTCGTCCTCATAATTAGAATATGTCAATCTATATTGTGGTCATTTCGACTTGTGCGGTTCACTATTGCAAGAG
GAAAAAGTAAAATAAACTTCCAACTCATGATGAATTTTCTTTTCTATGTGATGTTCTCGGTGTATAGTCTGGAGGACCCACTTGGAATGTGCCAAAAGGGAGGCTAGATGGAAGAACATC
AAAGGCAAGTGACACCAGGCAATTACCAGCCCCCATCTTCAACATCTCTCAACTCCAACAGAGTTTCTCCCAGAGAGGCCTTTCCATGGAAGATTTAGTGGCTCTATCAG
GTAAGACATT
ACACAAGCGTTTGGTAAAACTTTTAAAAGTTAAAAGGTTTGAATGGGTCAACATTTTTTCGCCTAGATTTGATTGCGATTTCAACTATGAAAAAGATTATATTTGCCTACTTTGCACTAT
CCATTCACAGGATACTTTTTTGACATGACCACTTAGTTTTTAATCGCATCATCACAGGATGTGATTTGGCAGCTACGCCGTGTTACCGTCATGTAACATTACTTNTATCCGCATGCATGC
AGGAGGCCACACGCTGGGATTCGNTCACTGCTCATCGTTCCAAAACAGGATACACAACTTCAGCCCCACCACCGACGTGGACCCATCGCTGAGCCCATCCTTCGCGGCGAACCTACGCAA
CGTGTGCCCGTTGGGCAACACGGCAAAGAATGCCGGATCGACGCTGGACTCAACCACCACCACCTTCGACAATGTCTACTTCAAGATGCTGCGTCAGGGCCAGAGCATCTTCTCTTCGGA
TCAAGCCCTGCTCACGAACCCG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCATCCCTAGTTGCTCTCGTCTCTGCTTTTCTCATCCTTCAAATTCTCTCTCCTGTCGACGCACTAAGTACAAACTACTATGACCACACTTGCCCCCAGCTCGAGGCTACGGTCACG
GCTGCTGTCAAGCAAGCCATGATGAATGACAAAACTGTTCCGGCTGCACTCTTGAGGATGCACTTCCACGACTGCTTCATTAGA
GGGTGTGATGGTTCTGTTCTGCTGAACTCAACGGGA
GGCAACACAGCAGAGAAAGATGGGCCTCCCAATATCTCACTGCATGCCTTCTACGTTATCGACAATGCGAAGAAGGCAGTGGAAGCACTGTGCCCCGGTGTCGTCTCCTGTGCAGACATC
TTGGCTCTCGCTGCTCGCGATGCTGTTGCTCTG
TCTGGAGGACCCACTTGGAATGTGCCAAAAGGGAGGCTAGATGGAAGAACATCAAAGGCAAGTGACACCAGGCAATTACCAGCCCCC
ATCTTCAACATCTCTCAACTCCAACAGAGTTTCTCCCAGAGAGGCCTTTCCATGGAAGATTTAGTGGCTCTATCAG
GAGGCCACACGCTGGGATTCGNTCACTGCTCATCGTTCCAAAAC
AGGATACACAACTTCAGCCCCACCACCGACGTGGACCCATCGCTGAGCCCATCCTTCGCGGCGAACCTACGCAACGTGTGCCCGTTGGGCAACACGGCAAAGAATGCCGGATCGACGCTG
GACTCAACCACCACCACCTTCGACAATGTCTACTTCAAGATGCTGCGTCAGGGCCAGAGCATCTTCTCTTCGGATCAAGCCCTGCTCACGAACCCG

Retrieve as FASTA