Entry information : EguPrx93
Entry ID 11546
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EguPrx93
Name EguPrx93
Class Class III peroxidase    [Orthogroup: Prx024]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx93
start..stop
S start..stop
EglPrx93 762 0 1..399 1..399
EcamPrx93 760 0 1..399 1..399
EgrPrx93 756 0 1..399 1..399
VvPrx95 458 5e-162 4..399 10..368
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 20490..20855 366 N° 2 21273..21461 189 N° 3 21582..21747 166 N° 4 21899..22374 476
join(20490..20855,21273..21461,21582..21747,21899..22374)


exon

Literature and cross-references EguPrx93
Protein sequence: EguPrx93
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   399 (378)
PWM (Da):   %s   43010.27 (40994.1)  
PI (pH):   %s   5.24 (5.24) Peptide Signal:   %s   cut: 22 range:22-399
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MDXIXKLSLLXVLLCIYIALTNPNADTMRKNSPSVLWFPPPSRFTRNLSSRLMSWPRPYDGYLNGVDSATRDSAESLXYDYYRESCPQAEKIIRETVRQIYGVHSGVXPALLRLVFHDCFIKGCDASVLLDSTQVMNAEKDTPPNETLKGFDVIDVIKAEIEEVCPSVVSCADILVLAAREGLLMAGGPFYPLSTGRRDSTHSYADLATYQLPSPYGDLSDTIASFGSRGFDEREIVNLLGAHSIGVIHCKSFQSRLYNFSGTNEPDPSLDVGFLDLMRSKCSKSVSASPSLSPXPSSSQSSFDFSNLTSEEPGVVMNYEGPSSGFGTLYYHRLLQGKGVLYADQQLMVGEETGSWVRAYASDVSLFRRDFAETMMKLSNLQVLTAPNGXVRHSCSKA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_6_21852 (20490..22374)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACTGNATCANGAAACTGAGCCTCCTCANGGTCTTGCTCTGCATCTACATTGCCCTCACCAACCCGAATGCCGATACCATGAGGAAGAACTCACCCTCGGTTCTCTGGTTCCCGCCT
CCCTCGCGCTTCACTAGGAATCTCTCGTCTCGGTTGATGTCATGGCCTCGACCGTACGACGGCTACCTCAATGGAGTTGACTCGGCGACGCGTGACTCAGCTGAGTCGCTCNAGTACGAT
TACTATCGCGAGTCGTGCCCACAAGCCGAAAAGATCATCCGAGAGACAGTCCGGCAAATCTACGGTGTTCATTCGGGTGTGGNTCCCGCTCTGTTGCGGCTTGTCTTTCACGACTGCTTC
ATCAAG
GTGATTGCCATTCTGATATGTCATTGTCTGCCGNAAGGGGTTAGGGCTTCTAATTTCTTTGTTAATTTGATTATAGTATCTTAGTATGTTCCTGGTCGCGAGTTCTNATTACTG
TGTTTCGAAGAATTNTTTCGTAATGCTATTGTCTATCTTTATGTTGTTGCCCGTATTTGGTGTTTTTGATACTGACTGTGAAGTCAATAGTGGGGTTTTGCTCCATGTTTATNTCGCTGT
GTTTCTTTAGCGATTCGGGTATAGTTGCAGCCATTGGAAATTCCACTCCTGTTGGGTGTGTTTTTCATGAATCTTCGTATTGTTTTCCTGTTGATTTTTGGGTCTTTTTCAATTCATTCC
TTTGATCGTAGACGTGACCATCTGACATTTGTAATATCTCCTGCCGAGACGAAACTGACGCAGGGATGCGATGCTTCCGTTTTGTTGGACTCGACCCAAGTGATGAACGCAGAGAAAGAT
ACGCCTCCAAATGAGACACTGAAGGGTTTTGACGTCATCGACGTCATCAAGGCCGAGATCGAAGAGGTCTGCCCCAGTGTCGTATCGTGCGCGGACATTCTTGTTTTGGCGGCCAGAGAA
GGCCTTCTCATG
GTAATTCTCTCCACCAGGATACTGCAACGTGCACATCTCCACAAATGTGATAAAAGGTCATTCAATTTTCTGACCGAATCCAAATTTGAGATTTTTGCGTACTGAGTT
GTGGAATTTCAGGCTGGAGGTCCATTCTATCCCCTGAGCACTGGCAGAAGAGACAGCACGCATTCATACGCAGATCTAGCGACTTATCAGCTTCCTTCACCATATGGAGATCTCTCCGAC
ACAATCGCGTCTTTTGGATCAAGAGGATTCGATGAAAGAGAGATTGTCAATCTGCTCG
GTATCTTGCTTATCTTGATTTTTTTGCTCGCGTAATAAATGTTTCCAAGCTTAGTAACTCCT
TACTATGAAGTGGCCAATTTCTGAAACTAGCATTTATGTGGATGCAATCAATGGTTGCGCTAGATTAACTCAAATCTGATATGTTTCAGGAGCTCACAGCATCGGAGTTATTCACTGCAA
ATCGTTCCAGAGTCGTCTCTACAATTTTTCCGGGACTAACGAACCTGACCCATCTCTAGATGTTGGATTCCTCGACCTAATGAGATCCAAATGCAGCAAGAGTGTCTCAGCGTCTCCATC
GCTGTCTCCGGNTCCATCATCATCCCAAAGCTCGTTTGACTTCTCGAATTTGACATCTGAAGAGCCCGGTGTAGTGATGAACTATGAGGGGCCGAGTTCTGGTTTCGGGACTCTGTACTA
CCATAGGCTGCTGCAAGGTAAAGGGGTTCTCTATGCGGATCAACAGCTCATGGTGGGAGAAGAAACGGGGAGTTGGGTCAGAGCATACGCCTCNGATGTCTCTTTGTTTCGCAGAGATTT
TGCTGAGACCATGATGAAGCTGTCGAACCTCCAAGTCCTAACTGCTCCTAATGGTCANGTTCGACACAGTTGTTCAAAGGCTGCT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGACTGNATCANGAAACTGAGCCTCCTCANGGTCTTGCTCTGCATCTACATTGCCCTCACCAACCCGAATGCCGATACCATGAGGAAGAACTCACCCTCGGTTCTCTGGTTCCCGCCT
CCCTCGCGCTTCACTAGGAATCTCTCGTCTCGGTTGATGTCATGGCCTCGACCGTACGACGGCTACCTCAATGGAGTTGACTCGGCGACGCGTGACTCAGCTGAGTCGCTCNAGTACGAT
TACTATCGCGAGTCGTGCCCACAAGCCGAAAAGATCATCCGAGAGACAGTCCGGCAAATCTACGGTGTTCATTCGGGTGTGGNTCCCGCTCTGTTGCGGCTTGTCTTTCACGACTGCTTC
ATCAAG
GGATGCGATGCTTCCGTTTTGTTGGACTCGACCCAAGTGATGAACGCAGAGAAAGATACGCCTCCAAATGAGACACTGAAGGGTTTTGACGTCATCGACGTCATCAAGGCCGAG
ATCGAAGAGGTCTGCCCCAGTGTCGTATCGTGCGCGGACATTCTTGTTTTGGCGGCCAGAGAAGGCCTTCTCATG
GCTGGAGGTCCATTCTATCCCCTGAGCACTGGCAGAAGAGACAGC
ACGCATTCATACGCAGATCTAGCGACTTATCAGCTTCCTTCACCATATGGAGATCTCTCCGACACAATCGCGTCTTTTGGATCAAGAGGATTCGATGAAAGAGAGATTGTCAATCTGCTC
G
GAGCTCACAGCATCGGAGTTATTCACTGCAAATCGTTCCAGAGTCGTCTCTACAATTTTTCCGGGACTAACGAACCTGACCCATCTCTAGATGTTGGATTCCTCGACCTAATGAGATCC
AAATGCAGCAAGAGTGTCTCAGCGTCTCCATCGCTGTCTCCGGNTCCATCATCATCCCAAAGCTCGTTTGACTTCTCGAATTTGACATCTGAAGAGCCCGGTGTAGTGATGAACTATGAG
GGGCCGAGTTCTGGTTTCGGGACTCTGTACTACCATAGGCTGCTGCAAGGTAAAGGGGTTCTCTATGCGGATCAACAGCTCATGGTGGGAGAAGAAACGGGGAGTTGGGTCAGAGCATAC
GCCTCNGATGTCTCTTTGTTTCGCAGAGATTTTGCTGAGACCATGATGAAGCTGTCGAACCTCCAAGTCCTAACTGCTCCTAATGGTCANGTTCGACACAGTTGTTCAAAGGCTGCT

Retrieve as FASTA