Entry information : EguPrx94
Entry ID 11547
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-01-22 (Christophe Dunand)
Peroxidase information: EguPrx94
Name EguPrx94
Class Class III peroxidase    [Orthogroup: Prx038]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx94
start..stop
S start..stop
EgrPrx94 657 0 1..326 1..326
EglPrx94 655 0 1..326 1..326
EcamPrx94 649 0 1..326 1..330
GmPrx64 446 9e-159 33..326 48..342
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 53976..54209 234 N° 2 53090..53432 343 N° 3 52420..52820 401  
complement(join(52420..52820,53090..53432,53976..54209))


exon

Literature and cross-references EguPrx94
Protein sequence: EguPrx94
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   326 (303)
PWM (Da):   %s   35011.72 (32684.4)  
PI (pH):   %s   8.52 (8.17) Peptide Signal:   %s   cut: 24 range:24-326
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKAFVSSALFLXALHLISATVRAGGLPVEAYGLSFQYYQESCPNFEAIVSRKVXEWIKKDYTLAPALMRLHFHDCVVRGCDASILLNYPGSEXSAAESKTLRGXEVINDIXAALEKSCPKMASCADILTSAARDATVLAGGPFWMVPYGRKDGRVSVAKEASKVPVGXENVTSLLQLFQSEGLNVLDLVVLSGAHTIGRSTCGSIQSRLYNYKSTGKPDPTLNREYGNYLKRKCRWASEYAYLDGRTPKTFDNMYYKNLQKKMGLLSTDQYLNSDSRTGPLVSALATQPELFNYQFGVSMAKLGNVQVLTGDEGEVRTNCNAVNR

Retrieve as FASTA  
Remarks Complete sequence from genomic (introns 1 and 3).
scaffold_6_22102 (54209..52420)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGTCGTCGGCGCTGTTTCTCNTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGNGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAANGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GTACGT
AGTTTGTCCGACNGCTTTTTCTTTTTTACTTTTTTTTTTAAATGAAAAAGGGCTAAAGCAGATTAAAAAAAGTTAACGTGNTAAATNTACTATTTCTATTTTATNANCTGATAATAATAA
NAAAAAAAATTAGTATTCCAGCACTTGTCAATTCCAAAGTTAGCAATCTAGTCAGCAGAGCAATTTCCTTCTCCAAAATTATGTTGGTCAGCATCAACCAAATNATTTTCGTANGTTTTG
CAAAAATCGCACTTATTAATAAAGTCGTCGCTAAGAAAAGCAAACAAAAATTTATTATCTAGTAGTGTCCACATATAAAAATGACATACATAAGGCAATTTCAAAATCATAATGAGAAGT
CTTTATAGTTAATGAATCAATACACTAACATTAATTAACTTATTGCATNATAATTTATATCTCACTCTNGATTGAGCTTTCTATAGACCAAATCGANAAATTTCGACATCCAAGTAAACC
AAAATGNGAATTTTTGCNGGCTTNATTTGACTCGAGTTTCTTGATTTGGTTGTGTAGGGATGCGACGCGTCGATACTATTGAACTACCCAGGGAGCGAGANGAGCGCCGCGGAGAGCAAG
ACTCTCAGGGGGTTNGAGGTGATCAACGACATAAANGCGGCGCTTGAGAAGAGCTGCCCGAAGATGGCNTCGTGCGCTGACATCCTGACCTCGGCCGCNAGGGACGCCACNGTGTTGGCC
GGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAGGCCAGCAAGGTGCCGGTTGGCCNCGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAA
TCCGAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GTGAACTTTTTCTCATTTCTTTTCACAAATCAACGAAAAAATAAATAAATAAAAAATTAAAGTCTAAAACACTATATTCC
ATTTTTTATTTNTTTATTATCTATATANCAATTTTAGTCTATAGGGTGCTTTTTGAATGGANGTGAGGATTAGTTTATGAAATTTTTATGGTCAACTTTGATTAAAAAAAATCACCATGT
ATTCTCAAATATAATTGAAATGTACATTTTTAATTTTATTCTTTTTCCTTCTTCTTGATCCGGGTGCAGGCGCGCACACGATAGGGCGAAGCACCTGCGGGTCCATCCAATCGCGGCTCT
ACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTACGCGTACCTCGACGGGAGGACCCCGAAAA
CCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCGCTCGTGTCGGCGCTCGCCACCCAGCCCG
AGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGCAACGCCGTCAACCGCTAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAAGCCTTTGTGTCGTCGGCGCTGTTTCTCNTCGCCCTTCACTTGATTTCGGCCACCGTCCGAGCAGGNGGGCTGCCGGTCGAAGCGTACGGGCTGTCGTTCCAGTACTACCAGGAG
AGTTGCCCCAATTTTGAGGCCATCGTGAGCAGGAAAGTGAANGAATGGATTAAGAAGGACTATACTTTGGCACCAGCCCTGATGAGGTTGCATTTCCACGACTGCGTCGTCAGG
GGATGC
GACGCGTCGATACTATTGAACTACCCAGGGAGCGAGANGAGCGCCGCGGAGAGCAAGACTCTCAGGGGGTTNGAGGTGATCAACGACATAAANGCGGCGCTTGAGAAGAGCTGCCCGAAG
ATGGCNTCGTGCGCTGACATCCTGACCTCGGCCGCNAGGGACGCCACNGTGTTGGCCGGCGGGCCGTTCTGGATGGTCCCGTACGGGCGCAAGGACGGGAGGGTCTCCGTCGCCAAGGAG
GCCAGCAAGGTGCCGGTTGGCCNCGAGAACGTCACGTCTCTCCTCCAGCTTTTCCAATCCGAAGGATTGAATGTCCTTGACTTGGTTGTTCTCTCAG
GCGCGCACACGATAGGGCGAAGC
ACCTGCGGGTCCATCCAATCGCGGCTCTACAACTACAAGTCCACCGGAAAACCCGACCCGACCCTCAACCGGGAGTACGGGAACTACCTGAAGCGGAAGTGCCGGTGGGCGTCGGAGTAC
GCGTACCTCGACGGGAGGACCCCGAAAACCTTCGACAACATGTACTACAAGAACTTGCAGAAGAAGATGGGCCTCCTCTCCACCGACCAGTACCTCAACTCCGACTCCCGGACCGGGCCG
CTCGTGTCGGCGCTCGCCACCCAGCCCGAGCTCTTCAACTACCAGTTCGGCGTCTCCATGGCCAAGCTCGGCAACGTCCAGGTGCTCACCGGCGACGAAGGCGAGGTCCGCACCAACTGC
AACGCCGTCAACCGCTAC

Retrieve as FASTA