Entry information : EguPrx98
Entry ID 11549
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-10 (Christophe Dunand)
Peroxidase information: EguPrx98
Name EguPrx98
Class Class III peroxidase    [Orthogroup: Prx016]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx98
start..stop
S start..stop
EgrPrx98 707 0 1..349 1..349
EglPrx98 700 0 1..349 1..349
EcamPrx98 649 0 1..349 1..341
GhPrx05 421 1e-148 40..349 17..323
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16915..17187 273 N° 2 17933..18115 183 N° 3 18276..18438 163 N° 4 18751..19178 428
join(16915..17187,17933..18115,18276..18438,18751..19178)


exon

Literature and cross-references EguPrx98
Protein sequence: EguPrx98
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   349
PWM (Da):   %s   37489.18 Transmb domain:   %s   i12-34o
PI (pH):   %s   8.4
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MLIMLRTKRRSSSSNVVATAIIAVLVPLVMHVMGSSESEGQEQQQLRVGFYSKSCPPAESIVHAVVKEAVLSVPRNAAVLLRIHFHDCFVEGCDGSILXDNGDISERHAGAHAGVGGFEIIEAAKARLESTCPGVVSCSDIVAMAARDAVLLSNGLFYEVQAGRRDGRVSNWTLAADMPDVNDSIHMLKAKFRQKGLKDKDLVLLSAAHTIGTTACFFMGTRLYQFXSTGGSDPAINPRFLPVLKSICPPGGDVNVRLALDAATEFVFDDLILHNIKNGFAVISSDARLYDSRHTRRIVDLYTQNGTSYKHEKPPSFKVDFAASMVKMGRIGVKTGSQGEIRRVCSSF

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
scaffold_6_22421 (16915..19178)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTCGTCGGAATCGGAAGGA
CAAGAGCAGCAACAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCATCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGATTCATTTCCACGACTGTTTCGTTGAG
GTGAATGATTTTGCCTTTTCCGCTCCCCTGAATAAACGTTTGTCTCTTTGCAATCAATGCGTCTTCATACACGACAGTTTTTAAATT
ATTAAATCGTGAGAAANTTTTTTCAGTAAATGTTCATAATCTAGTACTTGTTAATTAACTTTCCTTACTGAAGAAGCAGGAAAATGCGGTCGAATTGTTGCTTTGGTAGACTAGTCTCAC
TAAAATGTCAAGATAACATCGTACAAATGACAAAACCAGAGCAAGGATATTTANANACAAAGGTGTTATGGTTTGTCNTGTAATTGATGGTGTTACATCTTGTACAATAAATTTCGTGGC
AAATAGTACCAAATGNTCTAGTAAATATTTTTTACAGTTCCATCATGCGTGATCTTTGGTAAATAACCACCGATAGAAACCCTTGAAGTTACCCACTTTAATGGCTTCGGTGCATGATTT
TTGGGGATCGGGGATCGCTTTTGTGATATGCAAGGAGACAACATCATGGTCTGCTGAATAATTAAAAGGGCGGCACTGGAATTTCGTGGGACGACCTTCATTATTTTGGCTTGAGAACAG
CAAATGATCGGTCATAAGAAGGGACTAAATCGACCTTGAAANTCTTTTTTCCGTCAATGATTTTATCAGTGTTATTGCTCCTTCTCCACAGACCCAATAGNCAGTAATTTGTGNTGACGT
GGTAATTAATTTACACTAATTGTTGAGCAGTTTCTGATGACATATACATGTTAAACAGGGATGCGACGGGTCGATCCTGATNGACAATGGGGATATCAGCGAGCGGCACGCAGGGGCACA
TGCGGGTGTCGGAGGCTTTGAGATAATTGAAGCGGCCAAAGCTCGCTTGGAAAGCACTTGTCCTGGGGTCGTCTCTTGCTCCGATATCGTGGCTATGGCTGCNAGAGATGCTGTTCTCTT
G
GTACTTACTTTCCCCATCTTATACTCTTGCTGGCACAGATTTTGCTATCCAAATGCCATTTGATAGCTCTTTCCTTTAGAAGGAAAGTAAAAAGGGAGAGANAGGTGTCAATTTTGATT
GCTCTGGTGGATTGAAGTTGTGTTGGCTTCATATGGTGCAGAGCAATGGCCTGTTCTATGAGGTGCAGGCGGGGAGAAGAGACGGCCGNGTCTCAAACTGGACGCTCGCTGCAGATATGC
CGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTTAGACAGAAGGGGCTTAAAGATAAAGACCTCGTTCTTCTCTCCG
GTACGCCGCTCTTTACTAGTCAGCAGATGTGATTTA
TCAGCACAGCCGATTAATTACTCGGATAATATGTTAATATAGTCTAAAGTCTTAACAATNAGTAACATGACCATGTCAAGACGAAGCAGGAATTTCCTCCTGAAACAACTACTCTTGCCT
TTAAGNTCCCCAAATGCATGTTCTAGAGCAGGAATTTCCTTCTGAAACAACTACTCTTGCCTTTTAGCTCCTCAGATGCATTTCTTTTTTCATCATTTGATATTCTAGAGCAGGAATTTC
CTTCTGAAACAACTACTCTTGGCTCTCCGTTTCTAGCTGCGCATACCATCGGAACAACCGCGTGTTTCTTCATGGGCACGCGGCTCTACCAATTCAANTCCACAGGCGGGTCAGACCCTG
CGATTAACCCTCGCTTCCTTCCGGTTCTCAAGTCCATATGCCCCCCCGGTGGNGATGTCAACGTGAGATTGGCTCTGGATGCCGCCACTGAGTTCGTGTTCGATGATCTGATACTTCACA
ACATCAAGAACGGATTTGCCGTGATATCTTCGGACGCGAGGCTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCAC
CGTCCTTCAAGGTGGATTTTGCAGCTTCGATGGTGAAGATGGGTCGGATTGGCGTGAAGACGGGTTCGCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCTGATAATGCTGAGGACGAAGAGAAGGTCCAGCTCCAGCAATGTCGTCGCGACGGCCATTATCGCAGTTCTCGTCCCCCTCGTCATGCATGTTATGGGCTCGTCGGAATCGGAAGGA
CAAGAGCAGCAACAGCTTCGAGTCGGGTTTTACTCCAAAAGCTGTCCACCGGCTGAGTCCATCGTCCACGCCGTCGTCAAAGAGGCGGTCCTCTCGGTCCCTCGGAACGCCGCCGTCTTG
CTTCGGATTCATTTCCACGACTGTTTCGTTGAG
GGATGCGACGGGTCGATCCTGATNGACAATGGGGATATCAGCGAGCGGCACGCAGGGGCACATGCGGGTGTCGGAGGCTTTGAGATA
ATTGAAGCGGCCAAAGCTCGCTTGGAAAGCACTTGTCCTGGGGTCGTCTCTTGCTCCGATATCGTGGCTATGGCTGCNAGAGATGCTGTTCTCTTG
AGCAATGGCCTGTTCTATGAGGTG
CAGGCGGGGAGAAGAGACGGCCGNGTCTCAAACTGGACGCTCGCTGCAGATATGCCGGATGTGAATGACTCGATTCATATGCTCAAGGCCAAGTTTAGACAGAAGGGGCTTAAAGATAAA
GACCTCGTTCTTCTCTCCG
CTGCGCATACCATCGGAACAACCGCGTGTTTCTTCATGGGCACGCGGCTCTACCAATTCAANTCCACAGGCGGGTCAGACCCTGCGATTAACCCTCGCTTC
CTTCCGGTTCTCAAGTCCATATGCCCCCCCGGTGGNGATGTCAACGTGAGATTGGCTCTGGATGCCGCCACTGAGTTCGTGTTCGATGATCTGATACTTCACAACATCAAGAACGGATTT
GCCGTGATATCTTCGGACGCGAGGCTCTATGACAGCAGACACACCAGGCGGATAGTTGATCTGTATACTCAGAATGGGACTTCTTATAAGCACGAAAAACCACCGTCCTTCAAGGTGGAT
TTTGCAGCTTCGATGGTGAAGATGGGTCGGATTGGCGTGAAGACGGGTTCGCAAGGAGAGATTAGGAGAGTTTGCAGCTCTTTCAAC

Retrieve as FASTA