Entry information : EguPrxII03
Entry ID 11550
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-03-25 (Christophe Dunand)
Peroxidase information: EguPrxII03
Name EguPrxII03
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type Xylem
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrxII03
start..stop
S start..stop
EgrPrxII03 330 2e-118 1..162 1..162
EglPrxII03 330 2e-118 1..162 1..162
EcamPrxII03 330 2e-118 1..162 1..162
CsPrxII02 300 7e-107 1..162 1..162
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 552..706 155 N° 2 1133..1212 80 N° 3 2434..2684 251  
join(552..706,1133..1212,2434..2684)


exon

Literature and cross-references EguPrxII03
EST ref. GenBank:   CT983977.1 [5' end]
Protein sequence: EguPrxII03
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   162
PWM (Da):   %s   17219.98  
PI (pH):   %s   5.64
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MAPIAVGDAIPDGTLAYFDEQDQLQQVSVHSLAAGKKAVLFAVPGAFTPTCSLKHVPGFIENAELLKSKGVDEILCLVNDPFVMKAWAKTYPENKHVKFLADGSAKYTHALGLELDLSEKGLGTRSRRFALLVEDLKVKAANIESGGEFTVSGADEILKA

Retrieve as FASTA  
Remarks Complete sequence from genomic and 2 ESTs. Scaffold_3_11183 (552..2684).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTC
TTCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
GTGAGGGCCGCCNACTGCTTTTTTCTTTCTCGCCGTTCCCTCGTCCTGCGTCGCCGCCGGTTTGCCGTCGCGCGCGGGAGGGGAG
GGAGAGCGGGGGTGAATCGCAGCGTGAATCGTTGGGAATTCTTTGCCTAAATTGACGGTTTCATTTCTGTTTTCTAGAATGTTCTGTATTTNTTGAGTAGTGTGGAAGTGGTGTTCGATG
CGATTAGCTTCGTACGGTCGTCGCGAGGCTGTTAGATGTTTGTTTGGACCGAAACGAGTCATGATTCGTAAGCACCTGAATTCGTTTGGAAAATAGTGCATTATGCTACGGCCTGCTCGA
TTAAAGATGAGGTTTTTGGAGTGAATAACGCTGGAATNGTAACTAGCGATTGTAGCTTCGATCTTGCGGTATAACCGTTGTTTGTATCGTTCGATTTGCAGTCTGAAGCACGTGCCGGGC
TTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCG
GTATATTCTTTATCTTTTTCCGTCTCTGTGCGATTTCTTTCGTTCTTTTTTTTTTCAGA
GATTGTGGACGATCGTTCCTCTTTATTTGTCGTCTAATATCGGCGTTTCTTGNTATATCCGCCGATGCTTTGTTTTAANGGTTACACCTAATGTTTCTGTCCTTACTATTGAGTAATGTA
GTGTAGTGCATCTGCTCGTTAGTGACGAGGTAAAGAAGCTATCTTCAGTGAGTCNCCAAATATAATGGTTTCAGCAAGCATCAAGAATCTTAAACTTATAATAACGGGGATTGGGGACTG
TACTGGTTTTCTGGAGATTACAAGGAAATGCAAAAGGGACTCCAGTTTTGANTTTGAGCANTTNTTTTNAGGCATTAGTCAGTAGTTGACCATTTCTTGTAGCGTTGCTTTCGTCACCCA
ATTGCTTGCCCAATTATTAGTTGGGAGTATTCACGAGTTGACTTTGAGCAGTTGTTACGAGGCATNAGTCAGTAGATAAATATATCATGTGTGATATTTTTCCTTGTTGCCGCTCTTCAA
AATCCANTTGCCGCTCTATCCATTAAATAGTTACAAACTGTTCTGGATAGCTTGCCTTCAGGCTTGGTAGTGTAGTTGGTGTAAGTCTAATNCCATCTAAAATNGTGCCTTGTGGTCAAG
AGAGATCCGATCATCTTGGCCTGGAATCTTCTTGGGAATCTTTAAATGGATGTGATTGGACACNCTCTCCCTCTCTGGGTGGGCCATGTGGTTTTACNTTTCAATCAAACTATTATGCTT
ATTAACCAAATGCTGGATTGCTAATGACACAGTGAGTTCAAGATCCTGCTTGGGAAACAACTACAGAAAGCTAGTCCAAAAAGAACTCGGTTTCTGGGTCCTAGGACACTTGAAAGAGCT
TGAATTGAAACTTTGCACCGTCATTAGTGAAAATATGGCTTTGCTTAACGCTCTCGTATCTTTACTTCTCTTGACTTTACTGCTGACCTTCCACCCCATANTGAGGATATGTGGCTGTGT
GAATTCCATATTTGATTCCAGAGTTGAGCTCCTAGATGTTGTATGGAGTCTATTAAAGAGTTTGCACCATCCTTTAGTTAATAAAACGTGTTAGCTTTAGAACAGATGGCAGTTTGTCTG
TCTTAGTTAATTCAGTCCTAACATGTGTTTTTTGTTTTTTTCCCCTGAATATCGTGATGCTCATTTTGGTCCTATTTTTCAGTGAATGACCCATTTGTGATGAAGGCGTGGGCAAAGACT
TACCCTGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTNAGTGAGAAGGGGCTTGGNACTCGCTCCAGGAGATTTGCT
CTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACNGTCTCCGGCGCTGATGAAATCCTTAAAGCTCTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCCCGATCGCCGTCGGCGACGCCATCCCCGACGGCACCCTCGCCTACTTCGACGAGCAGGACCAGCTCCAGCAGGTCTCCGTGCACTCCCTCGCCGCCGGCAAGAAGGCCGTCCTC
TTCGCCGTCCCCGGCGCCTTCACCCCGACTTGCAG
TCTGAAGCACGTGCCGGGCTTCATTGAGAACGCCGAGCTGCTGAAATCCAAGGGTGTGGATGAGATTCTGTGTCTCAGCGTGAAT
GACCCATTTGTGATGAAGGCGTGGGCAAAGACTTACCCTGAGAACAAGCATGTAAAGTTCTTGGCAGATGGTTCGGCGAAATACACCCATGCTCTTGGCCTCGAGCTTGACCTNAGTGAG
AAGGGGCTTGGNACTCGCTCCAGGAGATTTGCTCTCTTGGTCGAGGATCTCAAGGTGAAGGCAGCCAACATCGAATCCGGGGGAGAGTTCACNGTCTCCGGCGCTGATGAAATCCTTAAA
GCTCTC

Retrieve as FASTA