Entry information : EguPrxII02
Entry ID 11552
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-04 (Christophe Dunand)
Peroxidase information: EguPrxII02
Name EguPrxII02
Class Atypical 2-Cysteine peroxiredoxin (type II)    [Orthogroup: PrxII001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrxII02
start..stop
S start..stop
EcamPrxII02 391 9e-142 1..196 1..196
EgrPrxII02 390 2e-141 1..196 1..196
EglPrxII02 337 2e-120 1..196 1..195
CclPrxII05 326 2e-115 1..196 24..224
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 10993..11193 201 N° 2 10857..10886 30 N° 3 9317..9475 159 N° 4 8537..8631 95
N° 5 8260..8362 103  
complement(join(8260..8362,8537..8631,9317..9475,10857..10886,10993..11193))


exon

Literature and cross-references EguPrxII02
Protein sequence: EguPrxII02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   196
PWM (Da):   %s   20594.63  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASLLAKRSSSSVLGGLWTAAARTYASVAVGGDIVSAAPGVSLQKARSWDEGVSSKFATTPLKDIFEGKKVVIFGLPGAYTGVCSQQHVPSYKNNIDKFKAKGIDSVICVAVNDPYTXNGWAENLKAKDAIEFYGDFDASFHKSLDLTKDLSAALLGLRSERWSAYVEDGKVKALNVEEAPSDLKVSGAEVILGQ

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_2_3732 (11193..8260)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCTGTCCTCGGCGGCCTGTGGACGGCGGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCCGCGCCGGGC
GTTTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTCTCAAGGATATCTTCGAG
GTTGGTCTTCGATTTCTTGCTGATTGCTTCATTCGCAGT
GGAAGTTCAGCTTCTGAATTTTTACTAATTTGCTTTGCCTGGGCTTCATTCGGACATGGGATTTCAGGGCAAGAAGGTTGTCATTTTCGGTCTCCCGGTGAGTGAACTCTCCGNTCTTTC
ATGTCTGTAGTTTCGTGGGAAATAATCGAGCCCTTTTTGTCTTCTGGGCAGTTGATTCATGGGTGTCGATTGCAGCAAGCAATGTCTTCCTTATTTAGTGCTAACTTAGCGGCAAAGATT
GCTCTTTTTTTTCCGACATCTGANATGGTTATATAAGACAGAGGAGATGCGTCTGAATTGTCTAATGGGAATCGTTTCAATTATTCGTTTAATGGGTTGCTTTCATGTTCTCGCCTTATT
GGTTGGTGTCATTGTGCGGAGGCTTGAATAGATCGATAGATTATGATATGCAGCTAGACTTTGCCAATTTACATGAGAGAGTCTTGTTATGCTCTTTGATAGCAAAAATAGAAATCTTTC
TTTTGATCTCTGCAAAGTTCCTATTTTCAAAAAGCTGGAAGGAGTTTATACAAATCTGGACAAGAGCCTAATAAATGACATCGTATTGAAATTTAGTGTTTGACGCTTTTATGAAGTATT
GTCCCATTCTTCGAACATTTATTGTACTTGTGAAAAGGATAGGTGCTGGGTTCCTAGCGGAAACTTCAAAGGCATTGCAGTCCATAATATGAGATTGCATGCTAGTCCACCATNNTTAGG
TTCTGTGGTTCACTTACTTCATGATCCTAGCTGCATCATTGAGGAAAATTTGGACATAGAGGTGACTATCTAACCAACTTGTTATAACTTCCAACCAAAATGAAAGTAAAAAAGAAAAAA
AGATTTGGATTTAGACAATTTTAAATAAGTTTCGCCACACACTAATNNNNNNNNNNNNNTACTTTTTGATATCGAGNTGTTCAATACTAGATAAAAGTCAATCTAACACACTAAAAGCAA
AAAATAGAAATAAGAAGTTGAAAAACATGTTGCCTTGAACAAAACTTGCACAACAAAGTTAGTATGTTTAGAGAAAACTTTGTTGTTGTCTGNTAATAATGTAGTTTGATGTGATGCCAT
TTTTAATCTTCCATCTTACCTCTTACAGCATTTCTAGTTTTATATACACCATATTTCTATTTTTTTAATTTGTACCCAAGTCCTTGATGCTGAATTCATCTTGCATCTAATGCCCAAGAG
AGACTGCATATGTCAGTCTATGCAGTCTCTTCTCAATACCGTTGCATGTGTTTTCTCGGAATACATTATCCGGTTATAGTTCATGATGTGCATTATCTTGCCATTTTAACCTCGGAAACT
GAGACACATTAACTTTAAGAAGATTTGACATATTGAAGCTGTAGCTACTGCAGGTCAAATAATAAAGGATAGCAAGTTGATATTTAACAATTCTTTACTGGTTTTCCTTCTTTCTCTTCG
TGCTTTCTATTCAAGTCTTCCTATTTGATGTCTCCCAGGGTGCATACACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAG
ACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATNAATGGCTGGGCTGAAAATCTCAAAGCAAAAGATGCT
GTAAGTTACTAATTTTGAAACCCAATTCTTTGCTTCTANAGAT
GAACTACTGTGTCTGCCTTACATATTTGCGTGNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNTTGCGTGTTGAGTTCCTTGCC
TCATCTTTTTGATAATTTCTTNAGGAAAAATTTNTTGATTGTTGTGAGGATTTCTGGTATTGCCTCACATTTCTTCCTGCAACTTGTAGAACATCAATANGAGGTTACTTTCTTTTGTTT
TTATTTTCTTCAAGAGGATGACTCACCTTTATGTCACAACNTTCTGTTTGCAAAACTGTAAATGCATGTTGGTAGGTCATGCAGTGATCACAATCAGAGGTGAAATGGCAGTAGAGCAGC
TAGAATACTTACCTCAGTTTTATGGTTAGCGCCATCTTTAAAGAAAGTGTACTACTACAGAAGTTTTCTTGGGCAAAACAATCCATTTCCAGAGATGCAAATGAGGCTTCTTTTTTTAGA
GTAAATGTATGACACAGTGAAGGAAGGTGGTTCATGTATGCACAACAAGGAAAGCTTGATTTTTACCTTGTTTGTGAACTTCTGTCATCTCTGCCTCCCCACATTTTAAAGTGAAAGAAG
GCTCTGACATGAGCTTGTGCTTGTTTNTCTTAATCATAACAGATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTT
GGACTTCGCTCTGAAAG
GTATGCCCTAGGCCCTAATAAGTTAATATTGGACATCAAACACCTCCTTGAATCTCNTTCCGTCATTTTTACCTTTGGACCATCACTTTATGGATGAAATGCC
TAATTAAATGATCAGTTTGTCCTTGGATCTACTCTTTTTTTTTGGGTAATCAAATGGCTGCTCTGGTGTAGATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAA
GAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCGTCGCTGCTCGCGAAGCGCTCGAGCTCCTCTGTCCTCGGCGGCCTGTGGACGGCGGCGGCCAGGACCTACGCCTCGGTCGCCGTCGGCGGCGACATCGTCTCCGCCGCGCCGGGC
GTTTCCCTCCAGAAGGCTCGGAGCTGGGACGAGGGCGTGTCCTCCAAGTTCGCCACCACCCCTCTCAAGGATATCTTCGAG
GGCAAGAAGGTTGTCATTTTCGGTCTCCCGGGTGCATAC
ACTGGAGTTTGTTCACAGCAGCATGTGCCTAGCTACAAGAATAATATCGATAAGTTTAAGGCTAAAGGCATAGACTCTGTGATTTGTGTGGCTGTCAATGACCCCTACACCATNAATGGC
TGGGCTGAAAATCTCAAAGCAAAAGATGCT
ATCGAATTCTATGGGGATTTTGATGCTAGCTTCCATAAGAGCTTGGACTTGACTAAAGATCTCTCAGCAGCTTTGCTTGGACTTCGCTCT
GAAAG
ATGGTCAGCTTATGTGGAGGACGGGAAAGTGAAGGCTCTCAATGTGGAAGAAGCTCCATCCGACCTCAAGGTTTCTGGTGCCGAGGTTATTCTGGGACAGATA

Retrieve as FASTA