Entry information : EguKat11
Entry ID 11553
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-03-13 (Qiang Li)
Peroxidase information: EguKat11
Name EguKat11
Class Catalase     [Orthogroup: Kat001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguKat11
start..stop
S start..stop
EgrKat11 396 2e-143 1..204 1..204
EgrKat[P]08 399 2e-140 1..204 1..204
EguKat[P]06 391 2e-138 1..204 1..204
EgrKat[P]06 384 3e-135 1..204 1..204
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 8100..8246 147 N° 2 8441..8650 210 N° 3 8834..9088 255  
join(8100..8246,8441..8650,8834..9088)


exon

Literature and cross-references EguKat11
Protein sequence: EguKat11
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   204
PWM (Da):   %s   22807.27 Transmb domain:   %s   i20-42o
PI (pH):   %s   8.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASEVTSPLASRQRSFRVKAYWSFLAFHPYTSFCCWCVAISMCIGRNYSSAVHARGACAKGFFEVTHDISHLTRADFLQAPGVQTPVTVRFSILIQERGSPETLRDPRGSGVNFYTRGEGNFDLVGNNFPIFFIXDGMKFPDXVRALRPNPKSRXQENWRILDFFFHHPESLRLFTFLFDDIGSAQDYRHMQGSGVNTYTLINK

Retrieve as FASTA  
Remarks Complete sequence from genomic.
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGTGAGGTCACCTCACCTCTGGCCAGTCGNCAGCGATCATTCCGAGTCAAGGCATATTGGAGTTTTCTGGCTTTTCATCCTTATACATCATTCTGCTGTTGGTGTGTAGCCATT
AGCATGTGCATAGGAAGAAATTACTCG
GTNAACTACTCTGAGTCAAGGCATATTGGAGTTAAAAATATGCAGAGAGACGCAATAGAACCTAATTTTAGAGTAATGCTAAACGTGGAATAT
GCTTATGGCAAACTATCATCTACGTCACAGGTCCAATTCTTCTTGACGATTATCACCTTGTGGAGAAACTTGCCAACTTTGATAGGGAGAGGATTCCATAGAGTGCTGTCCATGCCAGGG
GAGCCTGTGCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCGTGCCGATTTCCTTCAGGCACCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCC
AAGAAAGGGGCAGCCCTGAAACCCTGAGGGACCCCCGGGGTTCAGGTGTGAACTTCTACACGAGAGGTGAG
GGTCGTTTTGGTAGTAGACATGAATGTGCAGTATGGACGGGCACGAGTA
TGATGCTCCCTGTGATGAATCCTTTCACAGGTGGCCTAAACTCGACCGATGCATATGGCAGTTCTCTTGTCCACATTGCATACATTTGTTTTGTTGCACTTTGCTATGTGATCTTTCCTT
TTCTGTTACTGCAGGGTAACTTTGATCTGGTAGGAAACAATTTCCCTATCTTCTTTATCNGCGATGGGATGAAATTCCCGGATANGGTTCGTGCACTTAGACCAAACCCCAAATCCCGCN
TCCAGGAGAACTGGAGGATCCTTGACTTTTTCTTCCACCATCCNGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGATTACAGGCACATGCAGGGCTCTG
GAGTTAACACCTACACTTTGATCAACAAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCAGTGAGGTCACCTCACCTCTGGCCAGTCGNCAGCGATCATTCCGAGTCAAGGCATATTGGAGTTTTCTGGCTTTTCATCCTTATACATCATTCTGCTGTTGGTGTGTAGCCATT
AGCATGTGCATAGGAAGAAATTACTCG
AGTGCTGTCCATGCCAGGGGAGCCTGTGCAAAGGGATTCTTTGAGGTCACTCATGACATTTCTCACCTTACCCGTGCCGATTTCCTTCAGGCA
CCAGGAGTTCAAACACCTGTGACTGTCCGTTTCTCCATCCTCATCCAAGAAAGGGGCAGCCCTGAAACCCTGAGGGACCCCCGGGGTTCAGGTGTGAACTTCTACACGAGAGGTGAG
GGT
AACTTTGATCTGGTAGGAAACAATTTCCCTATCTTCTTTATCNGCGATGGGATGAAATTCCCGGATANGGTTCGTGCACTTAGACCAAACCCCAAATCCCGCNTCCAGGAGAACTGGAGG
ATCCTTGACTTTTTCTTCCACCATCCNGAGAGCTTGCGCTTGTTCACCTTCCTCTTTGATGATATTGGTAGTGCACAAGATTACAGGCACATGCAGGGCTCTGGAGTTAACACCTACACT
TTGATCAACAAG

Retrieve as FASTA