Entry information : EguPrxQ01
Entry ID 11554
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-05 (Christophe Dunand)
Peroxidase information: EguPrxQ01
Name EguPrxQ01
Class Atypical 2-Cysteine peroxiredoxin (type Q)    [Orthogroup: PrxQ001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrxQ01
start..stop
S start..stop
EgrPrxQ01 531 0 1..296 1..296
EcamPrxQ01 515 0 1..296 1..298
EglPrxQ01 493 6e-179 29..296 1..268
PtPrxQ01 343 8e-121 84..295 1..212
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 9153..9246 94 N° 2 9415..9764 350 N° 3 9864..10001 138 N° 4 10420..10509 90
N° 5 10728..10943 216  
join(9153..9246,9415..9764,9864..10001,10420..10509,10728..10943)


exon

Literature and cross-references EguPrxQ01
Protein sequence: EguPrxQ01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   296
PWM (Da):   %s   32030.76 Transmb domain:   %s   i57-79o
PI (pH):   %s   10.67
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLSSDNLAAYWAGQARPTEDLVXSVQFRRSGRRRRRNATLADPVASRGAQHGSKRIIXLLFSLIFLGPFFFFPSSAPILSSTMATLSLPKHSLPSLLPPQTPRTQSPRTPTFLPKSTQSQFHGLKLSNSSSPSVPXSFSAKSTVFAVNKGQAPPAFTLKDQDGKTVNLSKFKGKPVVVYFYPADETPGCTKQACAFRDSYEKFKKAGAEVVGISGDDSSSHKAFAKKYRLPFTLLSDVGDKVRKDWGVPSDLFGXLPGRQTYVLDKNGVVQLIYNNQFQPEKHIDETLKFLQSA

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_3_7357 (9153..10943)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCTCGAGTGATAACTTGGCGGCCTACTGGGCCGGTCAGGCCCGGCCGACCGAGGATCTGGTCNAGTCGGTCCAGTTTCGCCGGTCAGGTCGAAGCCCCGCTCCCTCGAAACGA
AGGCCGGATGTTGTCGTGCCGCGAAGGGCCAGCAATCGTCCACGCCACGAACGACATTGGAAAAGCCAATGAACGACCGCTCCACCTTATCTTTCTTTTCACCACCACCCGACCAAAAAC
CCGATAACAAAAAAAAACACAGGAAGAAGAAGAAGAAGAAACGCAACGCTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACGGCAGCAAAAGAATAATCNGTTTGCTCTTTTCTCTT
ATTTTTCTTGGGCCTTTCTTTTTTTTCCCTTCATCTGCTCCGATTCTGAGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGA
ACCCAATCTCCCCGGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCTCAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTNCTTCCTTCTCCGCCAAGAGCACC
GTCTTTGCCAAG
GTACATTGTCCCACGTCCAGANATTTGGAGGCATTTGGAGGGCTAAGCCAAGAGGGTTACTAATGTCTTCCCGTTTCTGTTTGTGGAAACTTCCTGCAGGTGAACAAA
GGCCAAGCCCCGCCAGCCTTCACGCTGAAGGATCAGGATGGCAAGACCGTGAACCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGCCAGGATGC
ACCAAGCAG
GTAACTTGAACGACCTGCTCTTCCAGTGTTCTTTTTTGTTGGTTTGTGGGGGAGATTCAAGTGNTTGGTCCTGTTGGACAATGGCAATCCGTGATAAGGGGCNTAACTTCT
TTTGCCCATTTATGTGCAGAGTGTCACTGTTCACAATCACTTGTCTTTCTCTCTCTTTTGCCGAATATGGTGGTGAAATGAGTATGCTCTGAGCTAGACTGCGCCCAATTGCTTTACTTT
CTTTGAAAGAATTTGAGTACAATGTGTTGAGTTGCTCAGTGTAGCTAATAGCTATTGATAGATAGAGATGAATTCAGCGATTTCTCCGTTCAACTGGAGCTTCGGTCTANNCTAGACCTT
GCTGAATCGACCGCAGGGAATTTTCCTTGTGAAGAATTGGGTTTACTAAGCANGCCGTTTNTGTCAGGCCTGCGCTTTCAGGGATTCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGT
GGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAAG
GTATTGGACAAAGTTCATCTGTTTCCTGTAATTGATTATGTGTTGGCATCATTTGAGCTTTTGGAAAATTAATGCTGAAAGCT
GTAGGAACAAGTGATAGATTTGTCAGGAATGTTTAAGTCTTTCGGGGTACATGTTTAATGAAACTGAAATACTCGGATTTTGCACCAAAATGCTAATGTTTCGCTGCTGACAATGAGTTT
CATTGTTAACGTCAGGCATTCGCCAAGAAGTATAGACTTCCATTCACATTGCTCAGCGATGTCGGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGNCATTGCCT
GGAAGACAGACTTACGTACTCGACAAGAATGGTGTGGTTCAGCTCATTTACAACAACCAATTCCAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCTCTCTCGAGTGATAACTTGGCGGCCTACTGGGCCGGTCAGGCCCGGCCGACCGAGGATCTGGTCNAGTCGGTCCAGTTTCGCCGGTCAGGAAGAAGAAGAAGAAGAAACGCAACG
CTTGCTGATCCGGTCGCAAGCAGAGGCGCACAGCACGGCAGCAAAAGAATAATCNGTTTGCTCTTTTCTCTTATTTTTCTTGGGCCTTTCTTTTTTTTCCCTTCATCTGCTCCGATTCTG
AGCTCAACGATGGCCACGCTTTCCCTCCCGAAGCACTCCCTCCCGTCTCTGCTCCCACCTCAGACGCCCAGAACCCAATCTCCCCGGACCCCAACGTTCTTGCCCAAGTCGACGCAGTCT
CAGTTCCACGGCCTTAAGCTGTCCAATTCCTCCTCTCCCTCCGTCCCTNCTTCCTTCTCCGCCAAGAGCACCGTCTTTGCCAAG
GTGAACAAAGGCCAAGCCCCGCCAGCCTTCACGCTG
AAGGATCAGGATGGCAAGACCGTGAACCTCTCTAAGTTCAAGGGCAAGCCCGTCGTCGTCTATTTCTACCCTGCTGACGAGACGCCAGGATGCACCAAGCAG
GCCTGCGCTTTCAGGGAT
TCTTATGAGAAGTTCAAGAAAGCAGGAGCTGAGGTGGTTGGAATCAGTGGGGACGACTCGTCTTCGCATAAG
GCATTCGCCAAGAAGTATAGACTTCCATTCACATTGCTCAGCGATGTC
GGGGATAAGGTCAGGAAAGATTGGGGAGTCCCCTCGGATTTATTTGGGNCATTGCCTGGAAGACAGACTTACGTACTCGACAAGAATGGTGTGGTTCAGCTCATTTACAACAACCAATTC
CAACCTGAGAAGCACATCGACGAGACCTTGAAGTTCCTTCAGAGTGCC

Retrieve as FASTA