Entry information : ZmaPrx09 ( Zosma23g00120 [2.2])
Entry ID 11555
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2016-04-08 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-04-08 (Achraf Jemmat)
Peroxidase information: ZmaPrx09 ( Zosma23g00120 [2.2])
Name (synonym) ZmaPrx09 ( Zosma23g00120 [2.2])
Class Class III peroxidase    [Orthogroup: Prx014]
Taxonomy Eukaryota Viridiplantae Streptophyta Monocotyledons Zosteraceae Zostera
Organism Zostera marina    [TaxId: 29655 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value ZmaPrx09
start..stop
S start..stop
CmicPrx01 363 3e-126 15..338 6..324
EgrPrx125 360 8e-125 35..338 26..324
EcamPrx176 358 3e-124 16..338 8..325
MePrx88 354 1e-122 15..338 1..319
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 181376..181615 240 N° 2 181103..181306 204 N° 3 180654..180819 166 N° 4 180156..180562 407
complement(join(180156..180562,180654..180819,181103..181306,181376..181615))


exon

Literature and cross-references ZmaPrx09 ( Zosma23g00120 [2.2])
DNA ref. Phytozome 12:   scaffold_23 (181615..180156)
Cluster/Prediction ref. Phytozome Gene 12:   33174077
Protein sequence: ZmaPrx09 ( Zosma23g00120 [2.2])
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   339 (306)
PWM (Da):   %s   36807.6 (33410.9) Transmb domain:   %s   i11-33o
PI (pH):   %s   6.98 (6.98) Peptide Signal:   %s   cut: 33 range:33-338
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MESRGSRNGDLIMGFVVVFAVLLMGSTGSVTASDLKIDFYAQTCPAAEVLIKYITYVNVLENPSLSAKLLRMHFHDCFVEGCDASVLLDPVDNSTTATQVEKQARPNLTLGGFDFIDQAKQLLETVCPRIVSCADIVALATRDAISYKFGREMWQVPTGRRDGKVSLASNAIANLPPPFFNLTALRQSFSDKGLNLIDLVALSGGHTIGVSHCKTFLNRLYNFGGTGKADPTLEPSYADVLKKSCPATTTDNNKTVEMDPSSSFSFDTHYFTTVLKKKGLFTSDAVLLDDPAAVAAIERFRDSDNFYKQFGKSMEKMGGIGVLTGTDGQIRRNCRLVN*

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGCAGAGGTTCAAGAAATGGCGATCTAATTATGGGTTTCGTTGTGGTGTTTGCAGTGCTTCTGATGGGGAGTACTGGTTCCGTTACTGCTAGTGATCTTAAGATTGATTTTTAT
GCACAGACATGTCCGGCAGCGGAAGTACTGATCAAGTACATCACTTACGTCAACGTCTTAGAAAATCCATCTTTGTCGGCTAAGTTACTTCGAATGCATTTCCATGACTGCTTCGTCGAG
GTAGTATTTAAGGGTTTATGAATTCTGGATTTTGTAGACGAATTATTAATGAATGGCGATTAAGTGCAGGGTTGCGATGCTTCTGTACTGCTGGATCCAGTCGATAACTCCACCACCGCA
ACCCAAGTAGAAAAACAAGCACGTCCTAATTTAACACTTGGTGGATTCGACTTTATCGATCAAGCCAAACAACTGCTTGAAACCGTTTGCCCTAGAATCGTTTCGTGCGCTGATATCGTC
GCTCTAGCTACTCGCGATGCTATTTCTTATAAG
GTATGATCGAAGAAATTAACTCAATTAATCACAATCACTATTAAAATCGTCAATGGATAATCAAAATTCGAAATCCAAATTATTATC
TAAATCTAAACGAATTCGGATACTGTTAATATCCGTCGATAATTATCCCAATTCGATTCATTACTTTAATCGAATTCATATTCGGATAAATAAATACTAATCTAGATATTCGGATATAGG
GGTATCGATCAAAATTGAATTCGATATTATTCCACTTGTGTTTAGAGAAATGTGTAAGGAGTGATATATTATGTAGTTTGGAAGGGAAATGTGGCAAGTGCCGACTGGAAGAAGAGATGG
AAAAGTATCACTTGCTTCCAATGCCATAGCAAATCTACCGCCGCCATTCTTCAACCTCACCGCTCTCCGGCAAAGCTTCTCCGACAAAGGCCTTAACTTAATAGATCTCGTAGCATTGTC
AG
GTATATATATTGTGTTCTAACTAGTTTCCATTTTCCAACCATTTTTCAATAAATATATCTGTTTAATTTGTAATTTATTCCGACTTCCAAGGTGGACACACCATAGGAGTTAGTCACT
GTAAAACTTTCTTGAACAGACTCTACAACTTCGGTGGAACCGGCAAGGCTGATCCAACGTTGGAACCAAGCTACGCCGATGTGTTGAAGAAATCGTGCCCCGCCACTACTACCGACAACA
ATAAAACCGTTGAGATGGATCCCAGTAGTTCATTTTCGTTCGACACACACTACTTCACCACTGTTTTGAAAAAGAAAGGATTATTCACGTCCGATGCGGTTCTTCTAGATGACCCTGCTG
CCGTCGCGGCCATCGAAAGGTTTCGGGATAGTGATAATTTCTACAAACAGTTTGGGAAGTCCATGGAGAAGATGGGAGGAATTGGCGTGCTCACCGGAACTGATGGTCAGATCAGGCGTA
ACTGTCGCCTTGTCAATTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGAGCAGAGGTTCAAGAAATGGCGATCTAATTATGGGTTTCGTTGTGGTGTTTGCAGTGCTTCTGATGGGGAGTACTGGTTCCGTTACTGCTAGTGATCTTAAGATTGATTTTTAT
GCACAGACATGTCCGGCAGCGGAAGTACTGATCAAGTACATCACTTACGTCAACGTCTTAGAAAATCCATCTTTGTCGGCTAAGTTACTTCGAATGCATTTCCATGACTGCTTCGTCGAG
GGTTGCGATGCTTCTGTACTGCTGGATCCAGTCGATAACTCCACCACCGCAACCCAAGTAGAAAAACAAGCACGTCCTAATTTAACACTTGGTGGATTCGACTTTATCGATCAAGCCAAA
CAACTGCTTGAAACCGTTTGCCCTAGAATCGTTTCGTGCGCTGATATCGTCGCTCTAGCTACTCGCGATGCTATTTCTTATAAG
TTTGGAAGGGAAATGTGGCAAGTGCCGACTGGAAGA
AGAGATGGAAAAGTATCACTTGCTTCCAATGCCATAGCAAATCTACCGCCGCCATTCTTCAACCTCACCGCTCTCCGGCAAAGCTTCTCCGACAAAGGCCTTAACTTAATAGATCTCGTA
GCATTGTCAG
GTGGACACACCATAGGAGTTAGTCACTGTAAAACTTTCTTGAACAGACTCTACAACTTCGGTGGAACCGGCAAGGCTGATCCAACGTTGGAACCAAGCTACGCCGATGTG
TTGAAGAAATCGTGCCCCGCCACTACTACCGACAACAATAAAACCGTTGAGATGGATCCCAGTAGTTCATTTTCGTTCGACACACACTACTTCACCACTGTTTTGAAAAAGAAAGGATTA
TTCACGTCCGATGCGGTTCTTCTAGATGACCCTGCTGCCGTCGCGGCCATCGAAAGGTTTCGGGATAGTGATAATTTCTACAAACAGTTTGGGAAGTCCATGGAGAAGATGGGAGGAATT
GGCGTGCTCACCGGAACTGATGGTCAGATCAGGCGTAACTGTCGCCTTGTCAATTGA

Retrieve as FASTA