Entry information : EguPrx[P]103
Entry ID 11560
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]103
Name EguPrx[P]103
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]103
start..stop
S start..stop
EgrPrx[P]103 166 3e-56 1..83 1..83
EglPrx[P]103 116 1e-36 4..83 1..64
EcamPrx103 111 2e-32 1..54 184..237
EguPrx110 111 1e-31 1..54 263..316
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 84..242 159 N° 2 314..406 93  
join(84..242,314..406)


exon

Literature and cross-references EguPrx[P]103
Protein sequence: EguPrx[P]103
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   83
PWM (Da):   %s   9443.77  
PI (pH):   %s   7.41
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
NSYYHLLLNGEGLLISDQELYSSVLAIQTKKIAVQYAHDTAAFFQQFSESMVKMIAESCVIKTRLIFNLCWFFIQSRTYANSS*

Retrieve as FASTA  
Remarks Pseudogene from genomic (Short PS). scaffold_7_24531 (84..406)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTCCTACTACCACTTGCTCTTGAATGGAGAGGGATTACTCATCTCTGACCAAGAACTGTATTCAAGTGTATTGGCGATTCAGACCAAGAAGATTGCGGTACAGTATGCTCATGACACG
GCGGCTTTCTTCCAGCAGTTCTCCGAATCCATGGTCAAG
ATGGGGAACATCCCGAATTCGGATAGCTTTGTCAATGGAGAAATGAGGAACAACTGCAGATTTATCAATACATGATCGCTG
AGTCATGTGTAATAAAGACTCGTTTGATTTTTAATCTTTGTTGGTTTTTTATCCAGAGTCGGACATATGCAAACTCGAGCTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
AACTCCTACTACCACTTGCTCTTGAATGGAGAGGGATTACTCATCTCTGACCAAGAACTGTATTCAAGTGTATTGGCGATTCAGACCAAGAAGATTGCGGTACAGTATGCTCATGACACG
GCGGCTTTCTTCCAGCAGTTCTCCGAATCCATGGTCAAG
ATGATCGCTGAGTCATGTGTAATAAAGACTCGTTTGATTTTTAATCTTTGTTGGTTTTTTATCCAGAGTCGGACATATGCA
AACTCGAGCTAA

Retrieve as FASTA