Entry information : EguPrx[P]128
Entry ID 11566
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-21 (Christophe Dunand)
Peroxidase information: EguPrx[P]128
Name EguPrx[P]128
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]128
start..stop
S start..stop
EgrPrx[P]128 572 0 1..282 1..282
EglPrx[P]128 567 0 1..282 1..282
EcamPrx[P]128 497 2e-180 1..266 20..298
EgrPrx[P]127 366 8e-129 1..282 29..293
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 4621..4753 133 N° 2 3979..4133 155 N° 3 3692..3857 166 N° 4 3164..3555 392
complement(join(3164..3555,3692..3857,3979..4133,4621..4753))


exon

Literature and cross-references EguPrx[P]128
Protein sequence: EguPrx[P]128
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   279
PWM (Da):   %s   30239.38  
PI (pH):   %s   8.28
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MTFYRESCPRAEAIVRNITWSRVAANPALPAKILRLQFRDCFVRGTSAEKDTIPNRSLEGLDVIDEIKAELEAECPLTVSCANILVLAARDGVSFFGRAM*GVLTGRRDERVSLASEALDNLPSPASDFNTLQQQFADNGQGVPDLVALSVAHTIGVAHCVVFAKRLFNFTGNNDTDASLDPGYTATLKAQCSSPRNTVGLDPNSSSSFDSHYFVVLFRNQGLLTSDVTLLMDKRAANFAWIYRKFNVFLA*FGHSMKKMGAIAVLTNXGG*IRKNCRAV

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame; Both 5' and 3' ends are missing). Scaffold_8_29416 (4753..3164).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTATCGCGAGAGCTGTCCACGGGCTGAGGCGATCGTGAGGAACATCACGTGGAGCAGAGTGGCAGCTAACCCTGCACTACCAGCTAAGATTCTGAGGCTGCAGTTCCGCGAC
TGCTTCGTTAGGG
TACGCGCACATACAAGATCATAATGCATGTTCTCACGAGCNCAATTTAGTAGGACGATGCTTCGTAGAATTTACAGAGGAAGTGGGAAAAGATGACGAGTGAACTCG
CGTGAGGTCTTCCTGGCTAACTTATGTCACCCTAACTCATGCGTAGTACTTCACGCAAGTCATAAGCAACTATCCAATAGTTCAAAACCTGAGAAGAATGTCNCGGCTTAATGTTTACTT
CGATATCTCATGCACCTGCTCATCGAATCATGAAAGTTTGACATATATTGCGATGGACTAGCAAAATGGCTGTAGATAAAGATGCGTATGCGGGAAAAATAATTGGAACCTCTATTTGTC
AAACCAAAATGATCTCTTATTGTCCACTCATTATGTCCTCTCATCTTGAGTGTATGTTTTCGATGTNGTGACCTTTTGTACATTTGGCNTTTCCTCTATATATTTTTTACCTCTTACCAA
AAAAAAAAAAAAAAAAAAAGGGACGAGTGCTGAAAAGGACACCATTCCCAACCGGTCTCTAGAAGGACTNGATGTCATCGACGAGATAAAAGCAGAGCTCGAAGCGGAATGTCCCCTCAC
CGTCTCCTGCGCCAATATCCTTGTGCTTGCCGCTCGAGATGGCGTTTCCTTTCAG
TTACTAATTAAGAACTTACGCTTCGGCTCTTCCATGAATTGAAAAGTTGGAATTTGNGACTCTCC
ATTGCCCCTTCTAAGTAGTGAACATATAGTGACATGAATGAGAATGACGTGCGCACTTCGGAAGGGCAATGTAGGGGGTACTGACCGGGAGGAGAGATGAGAGAGTATCATTAGCTTCGG
AAGCCTTGGACAACCTTCCATCACCTGCTTCTGATTTCAACACCCTTCAGCAACAGTTTGCTGATAATGGCCAGGGAGTCCCTGATCTTGTTGCCCTTTCAG
GTTTGAAATTCACTAACT
TATATGTATTTATATATACAAATGTGGAAAATCTCTATCGTTTCTATTCATTACAAATCCTATCCAAACAATTTTATTAGATATTCCAGCCAATTTGATCACAAGATCTTTGTTTCAGTT
GCACACACCATTGGAGTGGCGCATTGCGTGGTGTTTGCCAAGAGGCTCTTCAACTTCACCGGCAACAATGACACTGACGCCTCGCTTGATCCGGGCTACACCGCCACGCTAAAGGCTCAG
TGCTCAAGCCCTCGCAACACTGTCGGGTTGGATCCCAACAGTTCCTCCTCATTTGATAGCCACTACTTCGTCGTTCTCTTCCGAAACCAAGGCCTGCTCACGTCCGACGTGACGCTGCTC
ATGGACAAGCGCGCGGCCAATTTTGCTTGGATTTACCGAAAGTTCAATGTCTTCTTGGCTTAGTTTGGTCACTCCATGAAGAAGATGGGCGCTATTGCAGTTTTAACTAATGNTGGAGGA
TAAATTAGAAAGAATTGCAGGGCTGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGACGTTTTATCGCGAGAGCTGTCCACGGGCTGAGGCGATCGTGAGGAACATCACGTGGAGCAGAGTGGCAGCTAACCCTGCACTACCAGCTAAGATTCTGAGGCTGCAGTTCCGCGAC
TGCTTCGTTAGGG
GGACGAGTGCTGAAAAGGACACCATTCCCAACCGGTCTCTAGAAGGACTNGATGTCATCGACGAGATAAAAGCAGAGCTCGAAGCGGAATGTCCCCTCACCGTCTCC
TGCGCCAATATCCTTGTGCTTGCCGCTCGAGATGGCGTTTCCTTTCAG
TTCGGAAGGGCAATGTAGGGGGTACTGACCGGGAGGAGAGATGAGAGAGTATCATTAGCTTCGGAAGCCTTG
GACAACCTTCCATCACCTGCTTCTGATTTCAACACCCTTCAGCAACAGTTTGCTGATAATGGCCAGGGAGTCCCTGATCTTGTTGCCCTTTCAG
TTGCACACACCATTGGAGTGGCGCAT
TGCGTGGTGTTTGCCAAGAGGCTCTTCAACTTCACCGGCAACAATGACACTGACGCCTCGCTTGATCCGGGCTACACCGCCACGCTAAAGGCTCAGTGCTCAAGCCCTCGCAACACTGTC
GGGTTGGATCCCAACAGTTCCTCCTCATTTGATAGCCACTACTTCGTCGTTCTCTTCCGAAACCAAGGCCTGCTCACGTCCGACGTGACGCTGCTCATGGACAAGCGCGCGGCCAATTTT
GCTTGGATTTACCGAAAGTTCAATGTCTTCTTGGCTTAGTTTGGTCACTCCATGAAGAAGATGGGCGCTATTGCAGTTTTAACTAATGNTGGAGGATAAATTAGAAAGAATTGCAGGGCT
GTTAAT

Retrieve as FASTA