Entry information : EguPrx[P]142
Entry ID 11569
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-22 (Christophe Dunand)
Peroxidase information: EguPrx[P]142
Name EguPrx[P]142
Class Class III peroxidase     [Orthogroup: Prx014]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]142
start..stop
S start..stop
EgrPrx[P]142 274 8e-97 1..151 1..151
EgrPrx144 236 2e-79 1..151 26..183
EguPrx144 231 2e-77 1..151 26..183
EcamPrx144 230 4e-77 1..151 7..164
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 42024..42296 273 N° 2 41948..42001 54 N° 3 41698..41823 126  
complement(join(41698..41823,41948..42001,42024..42296))


exon

Literature and cross-references EguPrx[P]142
Protein sequence: EguPrx[P]142
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   149
PWM (Da):   %s   16067.89  
PI (pH):   %s   5.66
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSCHAQLSFMFXDESCPNALTAIRTSIRIAVSRKRQMAASLIQLHFHNCFI*GCDESILLDNSTTNSSERDAP*NRGSVRSYEVIDYEKSESVSCADIVAVATRDASVAVGDPSWMVKLGRRDSTTVSPSLASSDLPSFQEGLEKLVPKFA

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' and 3' ends are missing; Stops in frame). Scaffold_9_33200 (42296..41698)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTGCCATGCACAGCTTTCCTTCATGTTTTNTGACGAGTCATGCCCGAATGCGCTCACCGCAATAAGGACTTCCATCAGAATCGCGGTCTCGAGGAAGCGCCAGATGGCTGCTTCT
CTCATCCAACTCCATTTCCACAACTGCTTCATCTAGGGTTGCGACGAGTCAATACTATTGGACAATAGCACCACCAACTCTAGCGAGAGAGACGCCCCATAGAATAGAGGCTCTGTGAGA
AGTTACGAGGTGATAGACTACGAAAAGTCAGAA
GTAGAGAAGATCTGTCCAGGAGTCGGTGTCTTGTGCGGATATTGTTGCCGTTGCAACTCGAGATGCTTCTGTTGCCGTAAGTCTTCC
CATAATTCTGAAGATATGCATCTTATGACCACTTCATTACTTTCAAATATCGACTACAAGTTTAAATCGTTTTCCTTACCAATATAACTGATGCTGTTTTGACGAGAATGTAGGTTGGCG
ATCCTTCTTGGATGGTGAAGCTCGGAAGAAGAGACTCGACCACCGTAAGCCCATCACTCGCATCAAGCGATCTTCCATCGTTTCAAGAAGGCCTCGAGAAACTCGTGCCTAAATTTGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTGCCATGCACAGCTTTCCTTCATGTTTTNTGACGAGTCATGCCCGAATGCGCTCACCGCAATAAGGACTTCCATCAGAATCGCGGTCTCGAGGAAGCGCCAGATGGCTGCTTCT
CTCATCCAACTCCATTTCCACAACTGCTTCATCTAGGGTTGCGACGAGTCAATACTATTGGACAATAGCACCACCAACTCTAGCGAGAGAGACGCCCCATAGAATAGAGGCTCTGTGAGA
AGTTACGAGGTGATAGACTACGAAAAGTCAGAA
TCGGTGTCTTGTGCGGATATTGTTGCCGTTGCAACTCGAGATGCTTCTGTTGCCGTTGGCGATCCTTCTTGGATGGTGAAGCTCGGA
AGAAGAGACTCGACCACCGTAAGCCCATCACTCGCATCAAGCGATCTTCCATCGTTTCAAGAAGGCCTCGAGAAACTCGTGCCTAAATTTGCA

Retrieve as FASTA