Entry information : EguPrx[P]147
Entry ID 11571
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]147
Name EguPrx[P]147
Class Class III peroxidase     [Orthogroup: Prx161]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]147
start..stop
S start..stop
EgrPrx[P]147 605 0 1..312 1..312
EglPrx[P]147 576 0 11..312 22..323
EglPrx148 570 0 1..312 11..322
EguPrx148 568 0 1..312 11..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 2518..2706 189 N° 2 2251..2442 192 N° 3 1999..2157 159 N° 4 1459..1854 396
complement(join(1459..1854,1999..2157,2251..2442,2518..2706))


exon

Literature and cross-references EguPrx[P]147
Protein sequence: EguPrx[P]147
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   311 (295)
PWM (Da):   %s   33341.61 (31688.8)  
PI (pH):   %s   7.61 (7.94) Peptide Signal:   %s   cut: 17 range:17-311
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
FTLACTLLLLMGCSDAQLSPDFYSKTCPNVFTAVKSRVESTVKKEPRMGASLLCLFFHDCFVNGCDGWVLLDDTPTFTGEKNAAPNRNSARGFEVIDDVKSVVEKVCPGVVSCADLLAITARDSIILLGGPSWNVKLGRRHGRTASQAAANNSLPSPASNLTDLISSFENAGLSTTDLVALTGSHSIGQAKCANFRAQIYNETDLDRSFGEIRRKNCPSSASPRDNNLAPLDLQSPVAFDNTYYTNLL*FKGLLHSNQHLFSGGSTDSLVRTYASSPSTFNSNFAAAMIKMGDILPLTGSDGEVRKNCRKIN

Retrieve as FASTA  
Remarks Pseudogene from genomic (stop in frame, 5' end is missing). Scaffold_10_33942 (1459..2706)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCACTTTGGCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAACGTCTTCACCGCGGTCAAATCCCGGGTGGAATCC
ACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGAAT
GTAAGCTACCATAAATTGACTTATCTTTCTTTCATTGTATCCTAGAAATTC
ATTTTGTCTTTCGTCTATTGCCAGGGCTGCGATGGATGGGTTCTTCTCGACGACACGCCAACTTTCACTGGTGAAAAGAACGCAGCTCCAAACCGAAATTCTGCCAGAGGATTCGAGGTC
ATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGTGTTGTTTCTTGCGCTGACTTGTTGGCCATCACCGCTCGAGACTCCATCATCTTG
GTAAGCCCTCCCAATCCCTCCAAA
AAAAATCACTACCCCATACAAGTACTACTCACAAATTTGCTCTAACTAAGATTGTGTTGAAATTTGCAGCTTGGAGGGCCAAGCTGGAACGTGAAACTCGGAAGGAGACATGGAAGAACC
GCGAGCCAAGCAGCTGCTAACAATAGCCTTCCCTCTCCAGCCTCAAACCTTACCGACCTCATATCTAGCTTTGAAAATGCTGGCCTCTCCACGACAGACTTGGTGGCT
TTATCTGGTACG
TACACTCATAAACACAATCCCGGACGGTTGCTGGAGTAATAATGCAAAAAGCATTTTCTTTTATTTTTTTATATTGTAAATGGAGAAAAAAAGAAAAAGAAAAAAAAGAGATACTAACTT
ATCATATCTGTTTTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTTCAGAGCTCAGATCTACAATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAAC
TGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCCCCACTCGACTTGCAGTCTCCCGTTGCATTTGACAACACTTACTACACCAACCTTCTCTAGTTCAAAGGACTGCTTCACTCC
AACCAGCACCTCTTCAGTGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGCAGCCCGAGCACCTTCAACTCCAACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCC
CTCACCGGATCAGATGGTGAAGTCAGGAAGAACTGTAGGAAGATCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTCACTTTGGCTTGCACCTTGCTTCTCCTAATGGGGTGCTCCGATGCCCAGCTTTCCCCCGATTTCTATTCAAAAACATGTCCGAACGTCTTCACCGCGGTCAAATCCCGGGTGGAATCC
ACTGTCAAGAAGGAACCTAGAATGGGAGCCTCCCTCCTCTGCCTGTTTTTCCATGATTGCTTTGTGAAT
GGCTGCGATGGATGGGTTCTTCTCGACGACACGCCAACTTTCACTGGTGAA
AAGAACGCAGCTCCAAACCGAAATTCTGCCAGAGGATTCGAGGTCATAGACGATGTCAAGTCTGTTGTGGAGAAAGTGTGCCCTGGTGTTGTTTCTTGCGCTGACTTGTTGGCCATCACC
GCTCGAGACTCCATCATCTTG
CTTGGAGGGCCAAGCTGGAACGTGAAACTCGGAAGGAGACATGGAAGAACCGCGAGCCAAGCAGCTGCTAACAATAGCCTTCCCTCTCCAGCCTCAAAC
CTTACCGACCTCATATCTAGCTTTGAAAATGCTGGCCTCTCCACGACAGACTTGGTGGCT
TTGACAGGTTCACATTCGATAGGGCAAGCGAAATGTGCAAATTTCAGAGCTCAGATCTAC
AATGAGACCGACCTGGACCGTTCCTTCGGTGAGATAAGGCGGAAGAACTGCCCAAGCTCAGCTAGCCCGAGGGACAACAATCTAGCCCCACTCGACTTGCAGTCTCCCGTTGCATTTGAC
AACACTTACTACACCAACCTTCTCTAGTTCAAAGGACTGCTTCACTCCAACCAGCACCTCTTCAGTGGCGGCTCCACGGACTCACTGGTGAGGACATATGCCAGCAGCCCGAGCACCTTC
AACTCCAACTTCGCAGCGGCCATGATCAAGATGGGGGACATCCTGCCCCTCACCGGATCAGATGGTGAAGTCAGGAAGAACTGTAGGAAGATCAAT

Retrieve as FASTA