Entry information : EguPrx[P]165
Entry ID 11575
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EguPrx[P]165
Name EguPrx[P]165
Class Class III peroxidase     [Orthogroup: Prx013]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]165
start..stop
S start..stop
EgrPrx[P]165 330 2e-116 1..170 112..281
EcamPrx126 238 3e-80 1..170 97..264
EgrPrx126 236 1e-78 1..170 143..310
EguPrx126 235 2e-78 1..170 143..310
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 460..606 147 N° 2 769..1128 360  
join(460..606,769..1128)


exon

Literature and cross-references EguPrx[P]165
Protein sequence: EguPrx[P]165
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   170
PWM (Da):   %s   17858.94  
PI (pH):   %s   9.29
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
WKLFSAKRTEHKLAANVLGNIPSPFQDFNALAXIFSKKGLNMNDLVVLS*SGAHSIXVAHCGTFSRRLYNFTGKGDXDPSLNATYAAFLXNRCPNPTNLATVVEMDXPXSXLSFNNHCFDILMENKGLFQSDVALSMNRDAAKVVQQLRMPATFFSEFGKSMKKMEAIT

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, stops in frame).
scaffold_11_36570 (460..1128)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAAGTTATTTTCCGCGAAACGAACGGAGCATAAGTTAGCGGCCAACGTGTTAGGGAATATTCCATCTCCTTTCCAAGACTTCAATGCCCTTGCACANATTTTCTCAAAGAAAGGCCTC
AATATGAACGATCTCGTCGTTCTCTCA
GGTAAACTAACATGACCTTTTTTCGGATTATCGAGTTACAATTTCATGACTTATATTTGGATTGTTAAATTAGCATTGAAGCTAATCAAAGTA
CATAACTTGACATACTGCCTTGAGTTAGACATTGCACAATATANTGAAATCATCTACATCTTTGTTCCTTGATCAGGTGCACATTCCATTNGAGTTGCTCATTGTGGCACATTTTCTAGG
AGGCTCTACAACTTCACTGGGAAAGGGGACNCNGACCCCTCTCTGAACGCCACCTACGCTGCATTCCTCCANAATCGGTGCCCTAACCCTACCAACCTGGCTACNGTGGTGGAAATGGAT
NNGCCAANNAGCNCACTCTCCTTCAATAACCATTGCTTCGATATTCTCATGGAAAACAAGGGATTGTTCCAATCNGACGTCGCACTCTCGATGAATCGAGACGCAGCTAAGGTGGTGCAG
CAGCTTCGGATGCCGGCCACGTTTTTCTCCGAGTTTGGCAAGTCGATGAAGAAGATGGAGGCAATAACC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TGGAAGTTATTTTCCGCGAAACGAACGGAGCATAAGTTAGCGGCCAACGTGTTAGGGAATATTCCATCTCCTTTCCAAGACTTCAATGCCCTTGCACANATTTTCTCAAAGAAAGGCCTC
AATATGAACGATCTCGTCGTTCTCTCA
TGATCAGGTGCACATTCCATTNGAGTTGCTCATTGTGGCACATTTTCTAGGAGGCTCTACAACTTCACTGGGAAAGGGGACNCNGACCCCTCT
CTGAACGCCACCTACGCTGCATTCCTCCANAATCGGTGCCCTAACCCTACCAACCTGGCTACNGTGGTGGAAATGGATNNGCCAANNAGCNCACTCTCCTTCAATAACCATTGCTTCGAT
ATTCTCATGGAAAACAAGGGATTGTTCCAATCNGACGTCGCACTCTCGATGAATCGAGACGCAGCTAAGGTGGTGCAGCAGCTTCGGATGCCGGCCACGTTTTTCTCCGAGTTTGGCAAG
TCGATGAAGAAGATGGAGGCAATAACC

Retrieve as FASTA