Entry information : EguPrx[P]166
Entry ID 11576
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EguPrx[P]166
Name EguPrx[P]166
Class Class III peroxidase     [Orthogroup: Prx074]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]166
start..stop
S start..stop
EgrPrx[P]166 634 0 1..319 1..319
EglPrx[P]166 565 0 1..319 1..297
EgrPrx167 459 1e-164 1..319 1..320
EguPrx167 454 1e-162 1..319 1..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 30309..30428 120 N° 2 31094..31288 195 N° 3 31322..31963 642  
join(30309..30428,31094..31288,31322..31963)


exon

Literature and cross-references EguPrx[P]166
Protein sequence: EguPrx[P]166
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   318 (293)
PWM (Da):   %s   33501.75 (31007.5)  
PI (pH):   %s   8.31 (8.03) Peptide Signal:   %s   cut: 26 range:26-318
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MASNTALKICXVFFVCSIASRPALAQLSNQNXYATRCPKAGCDASILLDDTAXFTGEKTAFPNVNSTRGFDVIDTIKSKVEKLCPGVVSCADILAVVARDSVVEVFYY*SLMEYTFEAIQRNSFLNLYGFIEFDLQLGGRSWQVQLGRRDSTTASLNAANTNLPAPTLNLSALITSFSNKGFTAKEMVALSGSHTIGQARCVTFRNRLYNENDISSSFAXSLKAQCPSSGGDNXLSPLDITSPTSFDSAYFSNLVSQKGLLHSDQQLFSGGSTXAQVTTYSKNLDLFKNDFAKAMVKMGGLSPLTGSAGQIRTNCKRVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (PS is missing, stop in frame).
scaffold_11_36684 (30309..31963)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAGCCCTCAAAATCTGCTTNGTTTTCTTCGTTTGCTCGATCGCATCAAGACCTGCCTTGGCGCAATTGTCTAACCAAAATTANTATGCTACAAGGTGCCCAAAAGCA
CTCGATACCATCAAATCCGCCGTGAAATCAGCAGTCGCCAAGGAGGCTCGCATGGGAGCATCTTTACTCCGTCTTCACTTCCACGATTGCTTCGTCAATGCAAGTCTCATTTGCTTTCTT
CCTCCGCTCTATGTTTTTGCGCTTCACGTCGTTCTCATACTTTTGTTGATGTGTCGCATCCATATCCTTTTCTTTATTCTTTTTTTCATTTGCGTTGGTTATATAATTCCACACATGTCA
CATACATTAGTGAGTACAGTAAGTTTAGTAGAAAAAATAATTCATAGAAAATTGTGACCAACGTTATGGACATTCGCATCTGTAAGGATTTTTGCAACAAGTGAGATACACAGGCCAATG
ATTCCATTAAATTAAGAAAGAACGGACAGTGAAACGATCATAGCACACCATTANANGACCTGCCAACCTTGTGNCTCTAAATTTGTCTTCTTCCTTTGTCCCTAATATTTTCTCCATATT
GTATTCTATTCTAACAGACGAAACGTCTCTCTCTTAGCATTCCTTTCCGATTGTTGGTCGGAAAAACNAAAACACTATTGATTTCCTCACAAGTCCAATATTTGGATGATCCTTCCTGAA
TCATTGGATCTTGTAAACCCAATAAGATGAACTATTNATGTTCTTTTTTGTAATATTTTCTACAGGGATGTGATGCATCAATTCTATTGGACGACACTGCNAANTTCACNGGAGAGAAGA
CNGCGTTTCCCAATGTGAACTCCACGAGGGGATTCGACGTGATTGACACCATCAAGTCAAAAGTGGAGAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCTTAGCTGTTGTTGCTA
GGGACTCNGTTGTNGAAGTA
AGTGCCCAACCCTGGAAATTTCTTGGAACGTAATTTTATTATTGATCACTAATGGAATATACTTTTGAAGCAATACAAAGAAACAGTTTCCTAAACTTAT
ATGGATTCATTGAATTTGATCTTCAGTTGGGTGGACGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCTAATACCAACCTTCCAGCTCCAACTC
TCAATCTCAGTGCCCTTATCACCTCTTTCTCTAACAAGGGCTTCACTGCTAAAGAAATGGTGGCACTCTCAGGATCTCACACAATAGGCCAGGCTAGGTGTGTGACGTTCCGGAACCGAC
TCTACAATGAGAATGACATAAGCTCGTCGTTCGCCANATCTTTAAAGGCCCAGTGCCCNAGCTCGGGAGGTGACAACAANCTCTCTCCTCTCGACATCACGAGCCCGACNTCCTTCGACA
GTGCCTACTTCAGCAACTTGGTGAGCCAAAAGGGCTTGCTTCATTCGGACCAACAGTTGTTCAGTGGGGGCTCGACGAANGCTCAAGTGACTACNTACAGCAAGAACTTGGATTTGTTCA
AGAACGATTTTGCCAAGGCCATGGTNAAGATGGGAGGCCTTAGCCCTCTCACNGGNTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTCCAATACAGCCCTCAAAATCTGCTTNGTTTTCTTCGTTTGCTCGATCGCATCAAGACCTGCCTTGGCGCAATTGTCTAACCAAAATTANTATGCTACAAGGTGCCCAAAAGCA
GGATGTGATGCATCAATTCTATTGGACGACACTGCNAANTTCACNGGAGAGAAGACNGCGTTTCCCAATGTGAACTCCACGAGGGGATTCGACGTGATTGACACCATCAAGTCAAAAGTG
GAGAAATTATGCCCCGGCGTCGTCTCATGCGCCGACATCTTAGCTGTTGTTGCTAGGGACTCNGTTGTNGAAGTA
TTTTATTATTGATCACTAATGGAATATACTTTTGAAGCAATACAA
AGAAACAGTTTCCTAAACTTATATGGATTCATTGAATTTGATCTTCAGTTGGGTGGACGGAGTTGGCAAGTTCAACTAGGAAGAAGAGATTCGACCACTGCGAGCTTAAACGCTGCTAAT
ACCAACCTTCCAGCTCCAACTCTCAATCTCAGTGCCCTTATCACCTCTTTCTCTAACAAGGGCTTCACTGCTAAAGAAATGGTGGCACTCTCAGGATCTCACACAATAGGCCAGGCTAGG
TGTGTGACGTTCCGGAACCGACTCTACAATGAGAATGACATAAGCTCGTCGTTCGCCANATCTTTAAAGGCCCAGTGCCCNAGCTCGGGAGGTGACAACAANCTCTCTCCTCTCGACATC
ACGAGCCCGACNTCCTTCGACAGTGCCTACTTCAGCAACTTGGTGAGCCAAAAGGGCTTGCTTCATTCGGACCAACAGTTGTTCAGTGGGGGCTCGACGAANGCTCAAGTGACTACNTAC
AGCAAGAACTTGGATTTGTTCAAGAACGATTTTGCCAAGGCCATGGTNAAGATGGGAGGCCTTAGCCCTCTCACNGGNTCTGCTGGTCAGATCAGGACGAATTGTAAAAGAGTCAAT

Retrieve as FASTA