Entry information : EguPrx[P]180
Entry ID 11582
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-11 (Christophe Dunand)
Peroxidase information: EguPrx[P]180
Name EguPrx[P]180
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]180
start..stop
S start..stop
EgrPrx[P]180 369 4e-133 1..183 1..183
EglPrx[P]180 369 4e-133 1..183 1..183
EcamPrx[P]89 346 1e-122 1..183 101..283
EgrPrx[P]89 338 2e-119 1..183 109..291
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 277..442 166 N° 2 606..988 383  
join(277..442,606..988)


exon

Literature and cross-references EguPrx[P]180
Protein sequence: EguPrx[P]180
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   182
PWM (Da):   %s   19137.3  
PI (pH):   %s   5.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LGGPTWTVQLGRRDSTTASLSAANSDIPSPLSDLSGLISDFANKGFSAKEMVALSGTHTIGRARCFLFRARIYNEENIDPAFAMS*RQNCPGAGGDGNLVPLETGNGDMFNNNCFKDLVSMKGLLHSDQQLFNXGSTDAQVKAYSLDSASFFADLANAMVKMGNLSPLTGTDGEVRTNCRKV

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stop in frame, 5' end is missing).
scaffold_6_19753 (277..988)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGGGTGGACCTACGTGGACCGTTCAACTAGGTAGGAGAGATTCAACCACCGCAAGTTTGAGCGCTGCAAACAGCGATATTCCTTCGCCACTCTCGGACCTTAGCGGTCTCATATCTGAC
TTCGCTAATAAGGGATTCTCTGCCAAAGAAATGGTCGCCCTCTCAG
GTGTTTCATCTAATTTACTTGGCCATGGCAAAAAATGTCATTAATCTAAGAGAGAAGTATCATTCTTTTGGTCT
TCGCACTCTGGAAAGGCTTTCTTTGATTGTCGCTGAAAGAAAATTGCCCGACCATGATCCACCGTCTTACATGCGCTTTTGTGCCGCAGGAACTCACACGATAGGCCGAGCAAGGTGCTT
CCTGTTCCGTGCTCGCATCTACAACGAGGAGAACATCGACCCCGCATTCGCCATGTCGTAGAGGCAGAACTGTCCCGGTGCGGGCGGGGATGGTAATCTCGTGCCGCTTGAGACCGGCAA
CGGCGACATGTTCAACAATAACTGCTTCAAGGACCTAGTGAGCATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACNACGGATCCACCGACGCGCAGGTGAAGGCCTACAGCCT
TGACTCGGCCTCCTTCTTCGCCGATCTGGCCAATGCCATGGTGAAGATGGGGAACCTCAGCCCCCTCACAGGAACGGATGGGGAAGTCAGGACCAACTGCAGGAAAGTTAAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TTGGGTGGACCTACGTGGACCGTTCAACTAGGTAGGAGAGATTCAACCACCGCAAGTTTGAGCGCTGCAAACAGCGATATTCCTTCGCCACTCTCGGACCTTAGCGGTCTCATATCTGAC
TTCGCTAATAAGGGATTCTCTGCCAAAGAAATGGTCGCCCTCTCAG
GAACTCACACGATAGGCCGAGCAAGGTGCTTCCTGTTCCGTGCTCGCATCTACAACGAGGAGAACATCGACCCC
GCATTCGCCATGTCGTAGAGGCAGAACTGTCCCGGTGCGGGCGGGGATGGTAATCTCGTGCCGCTTGAGACCGGCAACGGCGACATGTTCAACAATAACTGCTTCAAGGACCTAGTGAGC
ATGAAGGGCCTCCTGCACTCGGACCAGCAGCTGTTCAACNACGGATCCACCGACGCGCAGGTGAAGGCCTACAGCCTTGACTCGGCCTCCTTCTTCGCCGATCTGGCCAATGCCATGGTG
AAGATGGGGAACCTCAGCCCCCTCACAGGAACGGATGGGGAAGTCAGGACCAACTGCAGGAAAGTTAAT

Retrieve as FASTA