Entry information : EguPrx[P]182
Entry ID 11583
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]182
Name EguPrx[P]182
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]182
start..stop
S start..stop
EcamPrx[P]182 503 0 1..297 1..318
EguPrx[P]42 464 1e-166 1..297 1..315
EguPrx[P]46 455 3e-163 4..297 1..313
EgrPrx[P]42 442 5e-158 1..297 1..315
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 638..853 216 N° 2 2608..2796 189 N° 3 2919..3086 168 N° 4 3247..3564 318
join(638..853,2608..2796,2919..3086,3247..3564)


exon

Literature and cross-references EguPrx[P]182
Protein sequence: EguPrx[P]182
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   295 (270)
PWM (Da):   %s   30424.31 (27762.8)  
PI (pH):   %s   8.47 (8.10) Peptide Signal:   %s   cut: 26 range:26-295
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSVKRAILLLLRFLLGTTSAELSSTLYSTSCPSALDTIKCGMSSVVSSKARMGVPLPRLYFHDCFINCHGLILLEYTANFAEKKNVSPNANXIQVFEVIDMIKSQLESTCPRXVSXAXXLVVXA*DSIVALGGPSWTISLRRRDSTSASQSAAISNIPAPSLNLSDLISSFSSKGFTTKEXAALLGINTAYATSLKANCPSSVGDNNPSPLDVTSPTSFDNAFSKNLQIQKDLLNSN*QLFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSSSQIRKNYGKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (PS is missing, stops in frame). scaffold_1_1028 (638..3563)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAAT
GCAAGCCTCTCTGCTCTGAGTCCC
TCCTCTCTTTCCGATTGATTTTTACCTTTGTTTTTCTCTTTCATTCAAGCTGCGTGCAAGCGTGCATGCATGATGCATCTTCGTGCTTGTGCGTGTGAAGCATTCCAACCAACCACGTAG
TCAAAAGAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGCTGAGTCTGACACTTTTTGGTATTTTGTGGTGCCATGCATTTTTGTGAGTTTATTATA
TTATTAATAGATTTTGTTTGTTATAACAAAATAATNTTTTTGGTAAATGAAAAAAACTTTTTCATGAGTATCGTTAGTATACGCTGCCGGCGTAAAAATATTTTTTTACAAACGGGCTTA
TCCACCCTTAATTTGGCTGTTAGTGAGGGGTTTGGAATCTTCAAATCATGGATAAGAATGGTTATGTAAAGTTTTCTTTAGACCGATAGTGCACGCTTTAATTTTCTTATATTACAAAAA
ACGATGTTGTCGATCAGATGTATATGTGATTAACTACCTGGTTTAAATCCAATGAACTCGATGAATTGGATCACGTAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTTTATGGTAAA
TTATCATTTTTAATGAAATTTGTTAATCAAATGGTACTCTAAAATCTTATTAGATATTTGAACAAGCGAATCGCGNCTTGTGCATGGCCTCACTAGTTTGCTTCCACACAANTTTAGAGT
GTCAATCTAANTAAACCAATCAATTTAGTGTACCTACTTTGTTATNCTCTTCATCTTCTTTGTGCATAATTTTAGAGTAGTCTATATCCTAATGAGGGATAAGTACATTAAAAGTACCAA
AAGCTGTATACAANGCTCACTTTAGTGCTAAAAATTTTCGCCGGCTCACTTAAATGCCAAATCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAACGATCATCTAAGTTCCAACGACGAGAA
ATTCNAGCCAAATTGATTACGTCTCATTTATAATTAAAATTTTAATATGACTTGACAAATNTTTTAAAAACTCCAGTCCATGTGGCATTTTCACGTAGCATGCTTGGCACTGAAGTGATG
GCTTTTTAATAGCAACTAGTTCTAAAGTGATCACTTTAAACAAAATTTAGCATTTAAATGATCACTTTTTACAAATTTTGAACGACGTCGTTTATGTGTTATATGCTGACTAGGCACGTT
GGCGAGCCACGTAGGACTGAGAAATTAATAAAACACAATCACGTCNGATTTCTAGTAACCCAAACNNNAANTGACACTTAAAAGNTTNTTTTTTTTTTAAAAGTAGCACTTAAGTGATCT
AAAAAAANNTTTAACACTAAAGTGAGTATNNTACACAACTTTTGACANTTTTAGTATATTTATCCCTCCTAATGGAGCTTTCTCCATCAAACATGTCTCCATTTCAATCTCGACATTCAA
AGCCCGATTGGTTTTTTATGGATGCATTGTTCCTTCAGAGAAAACACGAAGCAAAGTCGNAAGGCACGAGAAAAGTTGGAGAACTTCCTATTTAGTGTCACCCCGTCAAAACTGGTGTCT
CTAGGCGTTCATGATGGGGACNAAAAGGTGGAAAAGGATAGGNGAAAAATTCAATGTCCGTACTCGATTTTCAGGAAAAATTATAGCCTTTAACCCGTTTGCAACCATTGAATTTAATGG
ACTCCAATCCCATCGATTTTCTATTTAGAAGGACTAATGTGTGGCGTAGATGCCACGGGTTGATTTTATTGGAGTACACCGCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCA
ATTNTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCCTNTGCCNACANATTGGTNGTTNCTGCNTGAGATTCCATCGTTGCC
T
TAANTGCACATNTTCTTCTCAATTCTAGTGATCAATTGTGAGGANAAAAAAATCACATGTTATGTTCTCCATGCTATATTAATACTAACACATATGGATTTATTTTTTACTTAATTTTGA
GTTAGGTGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTC
CTTCTCTAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTAGGT
CATTGTCTTTNTTTTTTTCACCTATTAAAAAAGAATTTATAATAATGCCCGATCAATATACTGAGAACAAT
TTACCAAACATTGTTTGATTGTTTGTTAACAAAATCGCACACGATAGGTCAAGCCTGATGCTTGACTTTCCAGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAG
CAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCNAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGA
ACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGC
TCACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAAT
TGCCACGGGTTGATTTTATTGGAG
TACACCGCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCAATTNTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCC
TNTGCCNACANATTGGTNGTTNCTGCNTGAGATTCCATCGTTGCC
TTAGGTGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGC
AACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTCCTTCTCTAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTAGGT
ATCAACACCGCATATGCAACATCACTG
AAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCNAAGAACTTGCAAATCCAAAAGGATCTTCTCAAC
TCGAACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAAC
CCGCTCACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAAC

Retrieve as FASTA