Entry information : EguPrx[P]188
Entry ID 11587
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-05-19 (Christophe Dunand)
Peroxidase information: EguPrx[P]188
Name EguPrx[P]188
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]188
start..stop
S start..stop
EgrPrx[P]188 335 7e-120 1..186 1..184
EcamPrx[P]188 236 2e-80 8..186 1..204
EglPrx167 201 2e-66 33..186 69..222
EgrPrx167 200 1e-64 33..186 167..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 7297..7392 96 N° 2 8188..8392 205 N° 3 11417..11665 249  
join(7297..7392,8188..8392,11417..11665)


exon

Literature and cross-references EguPrx[P]188
Protein sequence: EguPrx[P]188
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   183
PWM (Da):   %s   18965.31  
PI (pH):   %s   4.6
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
LEAKDILEIGEAMLVINYI*VKTIGIGLLYTEPKLNLSDLIXAFTNKGFTAQEMVALSGSHTIGXARCTTFRDQLYNESNMNXSFAAPSKANCPNSGGDNISPRNVTSPTSFDNG*FWXXKSQKGLLHLDQQLLEGGSTDDHVTVYSDNLGLF*NDFAAAMDKDXGFLSPLTGSSSXIRMNX

Retrieve as FASTA  
Remarks Pseudogene from genomic (5' end is missing, Stops in frame). Scaffold_11_36687 (7297..11665)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTGAAGCAAAGGACATCCTTGAGATCGGGGAAGCCATGCTGGTAATTAATTATATCTAAGTCAAAACAATTGGTATCGGGCTGTTATACACGGAAAGTGCCTAGTATAGTTGACATATA
CGTGCAATATATGTGCNATNTACGTGCAATATACGTGCAATCTTGAAAGATAAGGATAATTAACATAAATATCATCAGGACATTGTTAATATAACCATANCGTTATTTTAACCTAGTAAT
GGTGCAAGGGCAGCCACACATTTGCTTGATCNNATCGACCTCTACCTCGACACAATTGTCCGAGGAGAACTACTACGCAGCAAAGTGCCCGAAGGCACTTGAGACCGTGAGATCCAACGT
GAAGGCGGCGGTGGCCAAGGAGGCTCACATGGGAGCATCCTTGCTCCGACTTCACTTTCACAACTACTTCGTCAATGTAAGTGTCTTCCGCTTTCTAGCTCTATTCAAACCGTCTTCTTT
TTTTCATCTAATATTAACGAAAGTTATTTTTAATTTGTTTTATAGGGATGTGATGCATCCATTCTACTAGACGATACAACGAACTTCATCGGGAGAAGACAGCCCTTCCCAATGCAAACT
CTGTGAGAAGATTCNACTTGATCGACACCATCAAGTTGGAAGTAGAGAAGTTATGCCCCGGTGTTGTCTTGTGCGCTGACATCTTAGCCATTGCTGCTAGGGACTCCGTTGTCGCAGTAA
GTGCCAACCCTTGAAATTTCTTGAAACATCCACAGAGGCTATTATTTTTCCTGAACTTATTAGGATTCAATTTTTGATGTGTAGTTGGGTGGACCGAGTTGACAAGTTTAGCTCGGAAGA
AGGGTTTNGACCATGGCGAACGNAAGTGCTGCTAATACCAACCTTCCATCTCCAAAGCTAAATCTCAGCGACCTCATCANCGCTTTCACCAACAAAGGGTTCACTGCCCAAGAAATGGTG
GCACTCTCAGGATCTCACACCATAGGCNAGGCTAGGTGCACNACATTCCGGGACCAGCTCTACAACGAGAGTAACATGAACTNGTCATTTGCCGCTCCTTCGAAAGCCAATTGCCCCAAC
TCGGGAGGCGACAACA
ACCTTTCCCCTCCCATGTCCTTTGACAATGGCTACTTCCGAAACTTGGTGAGCCAAAAGGGCTTACTCCACTCGGACCAGCAATTGTTCAGTGNAGGTTCNACG
AATGCTCAAATGACTGCCTACAACAAGAACTTTGGCTCATTTCAGAAAGATTTTGCCAAGGCTGTGGTCAANATGGGTAGCCTTAGCCCTCTCACCGACTATCCCAGCTTAATTTTCGGA
AATTAATTAATTAATTATGGAAATTATTAGATAAATGCCATAAATCTAATTTAGGCCCATAATGCCTAATTGGANGTCGAAACAGACCCAGAAAATTTCCGAGATTCGTTCAATAAATAG
TAGAGCGTGTCTACTAGCTAACTACACTAACCAATTGCCTAACATGCATTGATAAGGCACTAATTTAATTACTCTACTCTAATCTATCCACCTAATTNCATTTAATTAAATCTAAACAAC
CTCTAAGCATCATTAGCCTACTAANTGAGGATTAGTGAGCAAAACTCACTTGATTAATAAGCGGGTCGGTACGAAATTTCGGGAATGTGATGGAGACCGACTATCCTCAAGGCAGGCCAA
GCAACCAAGGCTCGGGATCACCTCAAAACGGGCTTGGAAGCTTGCTGGAAACCACTTTTCTATTCTCTATTTGCTGCTAGTTGAGGGTCAATCCGAGGCAGGTTGAGGCGAGCAAGGGCT
GATGATGCTGCAGCAAGGCTGAGGGGCCAACGGTGGGGCTCGGCGGGGCTTGGACAACGATGGACAATCTCCGGCTGGGCTCGGGATAGCCATGGGACACACTGGCAGAGGCAGACGGGG
ACAGCTGGGCGCGGTGGCACGCAAGCGGATGGCGGAGCGCACGGGCGACGAACGGTGACGGTGGCGGCGTGCAAGCAACTCCTGTTGTCTCCAGCGGTACTGCTGGCTTCCTTGGTTGCT
GTGGCGTCGAACAGTAAGGGAGAGAGAGAGGAAGGAGTGAGGAACATGCTTGGCTTTGGTAGGGTCTCCTTGGCCAATTCTTCCAATGCTTTGTCCCCTTGACTCTTCCTTGGCCTAGTG
TTGTCCCTTGGCCCTCCTTCANCCAACAAGGCCTCCATATAGAAACTTATGGCNGTCCAAATGTTGAGGGTGGTGGGGGCATACGAAATTCCAAGCAAAAAGGCTTCAATTGGACACCCA
TCCGTGCTTAATTCAATCCAATTCGGCCTCAACAAATCCCGTAGTCGANTCAATACTCAATCTAGTATTTTTCCTCACCCATTGAACCATCTTGCATCCCAATTTCGTGATCAAAAATGG
TCTTGCCTTTTTTCCGAACAAAAATGGCCCTATAATGACTTTTTCCCAAAAAGTCTCGGGTTACAGAAAAACTTTCTGAGACTGAGTTGACATTCCTAGAATTTATTGTGACATAACAGA
ATCTTCAATTTTCGAAATTAGACTCAATTTCGCAGTTAATTTCACTCAAGCGCGTTTTTAGCGTGACCTAAGCTACCGGGTAATTTTCAGAAATTTTTAGTGCAANNNNNNNNNNNNNNN
NNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNNACGAACACANGGTACCAAATTGANAGAAGAATCAGTCTAGGGNT
GCTCGACGAGAATTTTCTAATTTAGTGGTGTCNNNNATGATTAGCCACATATCTTAGTCGAGTTAACCTATCTCTATTCTCAAATCAATTTTTAACTGTGTCGTAATGGCGTCTAAGGAT
GAGCACGGTCGAGAAGCTGATTCTTGGTTGAATTCTCGATCTATCGCATTAAAATTCTTTAACAGCTTCCCTGGATAATCTAATTATCTCGAGAGTGATCAGCTCTAAGAACAACCCTAT
AGGCGCGTCGATGAAATGCATGATTTATTCAATAAAAAATAGAAATGAAAATCTAGGATGTCACAATAATCCTATCATAATTTGTCCATAGTTCTCCTATAAATACCACCGGTCGAAGCT
CATGAATAATCCAAACCAACACACGACACTCATCTGAAGAGCTCTCCTTTGTCTCCCTCTCTTTCCCATCTAACTAGCCCCTTCAGTAATGTCCCCCAATATGCCCCAGAAACTATGCTA
CCACAATTTGGATAGGACCATATATGATCCCACTCAAATCCGATCCGATCCACTCATTTGACAAATGCAGGGGAAAATTGTCCGGGCTATAACAGGAGCCACTAGACACATGGTGATCAA
TGAGCGGAGAAAACTACGACTTACATGGAAGTCCAAGACTACACCATGTTTTTCTCGCCAAGGGAACTGAACTTTTGAAACATTGACCATTGAGATGCGGGAAAAAGATGCCGATGCTCT
CATTTTCTTAAAAGGCTTCCTGAGAAAGCCAGGGAGACAGAGCCCACGGGAACCGAACCAAGCAAAAAAGGAGGAAGAAGAAGGCCAACAAGCTTGGTTTCGCCCGCCCATGGAAGCGCA
GCTCCTAATGCCTCGTCCCCTACATTTATACTCCCCAGGCACGATCAAAGNTCCCGACTTGACCGCCACCGCCACCACCACCACCACCCATCATCGAAGCAACTCCACTGTCGTTTTGCC
AAATCTCTCATCAAAAGAGCTAATACGTGCAATGTATGTGCCATGTACGTGCAAGATACGTNCAATCTTGAAAGATAAGGATAATTAACGTAAATATCATCAGGACATAGTTAGTATAAC
CATACAGTTATTTTAACCTAGTAACGGCAGTCACACATTTCACTTTAGATGGAAAGGGNACCCAATACAACCTAGAAACTGTGCTTCCTCTTTTTNGTTTGCTTGATCGCATCGACGTCC
GCCTCAACACAATTGTTCGAGGAGAATTACTATGCAGTAAAGTGCACAATGGCGCTCGAGACTATGAGATCCNCCGTGAAATCAGCGGTAGCCAATGAGGCGTGCATGAAAGCATCCTTG
CTCCGTCTTCACTTTCATGACTGCTTTGTCAATGTAAGTCTCTCCCCTCGCAACGTCACAAGTCCTACATCCTTTGACAACGGCTAATTCTGGNNNNNNAAGAGCCAAAAGGGCCTACTC
CACCTAGACCAACAATTGCTCGAGGGAGGTTCAACAGACGATCATGTGACCGTCTACAGCGACAATTTGGGTTTATTCTAAAACGATTTTGCTGCTGCCATGGACAAAGACGNNGGATTC
CTTAGCCCTCTCACCGGGTCTAGCAGTCANATAAGGATGAATTGCAGGG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
CTTGAAGCAAAGGACATCCTTGAGATCGGGGAAGCCATGCTGGTAATTAATTATATCTAAGTCAAAACAATTGGTATCGGGCTGTTATACACGGAACCAAAGCTAAATCTCAGCGACCTC
ATCANCGCTTTCACCAACAAAGGGTTCACTGCCCAAGAAATGGTGGCACTCTCAGGATCTCACACCATAGGCNAGGCTAGGTGCACNACATTCCGGGACCAGCTCTACAACGAGAGTAAC
ATGAACTNGTCATTTGCCGCTCCTTCGAAAGCCAATTGCCCCAACTCGGGAGGCGACAACA
TCTCCCCTCGCAACGTCACAAGTCCTACATCCTTTGACAACGGCTAATTCTGGNNNNNN
AAGAGCCAAAAGGGCCTACTCCACCTAGACCAACAATTGCTCGAGGGAGGTTCAACAGACGATCATGTGACCGTCTACAGCGACAATTTGGGTTTATTCTAAAACGATTTTGCTGCTGCC
ATGGACAAAGACGNNGGATTCCTTAGCCCTCTCACCGGGTCTAGCAGTCANATAAGGATGAATTGCAGGG

Retrieve as FASTA