Entry information : EguPrx[P]34
Entry ID 11594
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]34
Name EguPrx[P]34
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]34
start..stop
S start..stop
EgrPrx[P]34 172 1e-57 1..98 37..134
EcamPrx38 158 2e-52 2..89 16..105
EguPrx[P]40 149 2e-48 2..87 44..131
EgrPrx[P]40 144 9e-47 2..87 44..131
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 16183..16275 93 N° 2 15858..16058 201  
complement(join(15858..16058,16183..16275))


exon

Literature and cross-references EguPrx[P]34
Protein sequence: EguPrx[P]34
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   98
PWM (Da):   %s   10702.5 Transmb domain:   %s   i73-95o
PI (pH):   %s   7.34
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SATIKRVIEAMVQQERRMGASLLRLHFHDCFGCDALMLLDLTPTIDSEKLTLHNNNSARGFKVIGQIKAEADGVCGCPVVSCVDILAITFMTLLLRYV

Retrieve as FASTA  
Remarks Pseudogene from genomic (Only short PS). scaffold_1_750 (16275..15858)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCCACCATCAAGCGCGTCATTGAGGCGATGGTGCAGCAAGAGCGACGCATGGGCGCGTCCTTGCTGCGCTTGCACTTCCACGACTGTTTCGTCAATCGAAGACATATACAGCTAAAT
TTCACATTAATTTGTTGTTCTAAAAAATAGTGATTACTATTTAGCATTGCACAATACTTGCTAACATTGATGTTTGTTTGGGAGTTCAATAATGCAGGGTTGTGATGCATTGATGCTCTT
GGATCTGACCCCGACCATCGACAGTGAAAAGCTTACGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATTGGCCAAATTAAGGCGGAGGCCGACGGAGTATGTGGATGTCCGGT
GGTTTCTTGTGTGGACATCTTGGCAATCACTTTCATGACTCTGTTGTTGCGGTACGTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCAGCCACCATCAAGCGCGTCATTGAGGCGATGGTGCAGCAAGAGCGACGCATGGGCGCGTCCTTGCTGCGCTTGCACTTCCACGACTGTTTCGGTTGTGATGCATTGATGCTCTTGGAT
CTGACCCCGACCATCGACAGTGAAAAGCTTACGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATTGGCCAAATTAAGGCGGAGGCCGACGGAGTATGTGGATGTCCGGTGGTT
TCTTGTGTGGACATCTTGGCAATCACTTTCATGACTCTGTTGTTGCGGTACGTC

Retrieve as FASTA