Entry information : EguPrx[P]40
Entry ID 11596
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx[P]40
Name EguPrx[P]40
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]40
start..stop
S start..stop
EgrPrx[P]40 243 4e-85 1..131 1..131
EgrPrx32 201 1e-65 1..131 1..132
EglPrx32 200 1e-65 1..131 1..132
EguPrx32 198 1e-64 1..131 1..132
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 1926..2150 225 N° 2 1640..1807 168  
complement(join(1640..1807,1926..2150))


exon

Literature and cross-references EguPrx[P]40
Protein sequence: EguPrx[P]40
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   131 (108)
PWM (Da):   %s   13699.06 (11351.7)  
PI (pH):   %s   6.23 (5.60) Peptide Signal:   %s   cut: 24 range:24-131
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MALGSLSLFRALLFLSLTASALATXXXXXSLSPHYDYECPQALATIKRVIEEMVQQERRMGASLLRLHFNDCFVNGRDALMLLDPTPTIDNEKLALHNNNSARGFKVIVQIKAEVDGVCGCLVVSCAEILA

Retrieve as FASTA  
Remarks Pseudogene from genomic (exons 1 and 2).
scaffold_1_754 (2150..1640)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTAGGTAGCCTCAGCCTCTTCCGAGCACTTCTCTTCTTGTCCCTCACGGCGTCAGCTCTCGCCACNNNNNNNNNNNNNNNCAGCCTCTCGCCACACTATGACTATGAATGCCCT
CAAGCCTTAGCCACCATCAAGCGCGTCATTGAGGAGATGGTGCAGCAAGAGCGACGCATGGGTGCGTCCTTGCTGCGCTTGCACTTCAACGACTGTTTCGTCAAT
CGAAGACATATACAG
CTAAATTTCACATTAATTTGTTGTNCTAAAAAATAGTGATTACTATTTAGCATTGCACAATACTTGCTAACATTGATGTTTGTTTGGGAGTTCAATAATGCAGGGCCGTGATGCATTGAT
GCTCTTGGATCCGACCCCGACCATCGACAATGAAAAGCTTGCGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATCGTCCAAATTAAGGCGGAGGTTGACGGAGTATGTGGATG
TCTGGTGGTATCTTGTGCGGAAATCTTGGCA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCCTTAGGTAGCCTCAGCCTCTTCCGAGCACTTCTCTTCTTGTCCCTCACGGCGTCAGCTCTCGCCACNNNNNNNNNNNNNNNCAGCCTCTCGCCACACTATGACTATGAATGCCCT
CAAGCCTTAGCCACCATCAAGCGCGTCATTGAGGAGATGGTGCAGCAAGAGCGACGCATGGGTGCGTCCTTGCTGCGCTTGCACTTCAACGACTGTTTCGTCAAT
GGCCGTGATGCATTG
ATGCTCTTGGATCCGACCCCGACCATCGACAATGAAAAGCTTGCGCTTCATAATAACAATTCAGCTAGAGGGTTCAAAGTGATCGTCCAAATTAAGGCGGAGGTTGACGGAGTATGTGGA
TGTCTGGTGGTATCTTGTGCGGAAATCTTGGCA

Retrieve as FASTA