Entry information : EguPrx[P]42
Entry ID 11597
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]42
Name EguPrx[P]42
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]42
start..stop
S start..stop
EguPrx[P]46 588 0 4..315 1..313
EgrPrx[P]42 574 0 1..319 1..319
EcamPrx[P]42 535 0 1..315 1..320
EgrPrx[P]46 520 0 4..315 1..313
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 638..856 219 N° 2 2611..2800 190 N° 3 2923..3086 164 N° 4 3192..3575 384
join(638..856,2611..2800,2923..3086,3192..3575)


exon

Literature and cross-references EguPrx[P]42
Protein sequence: EguPrx[P]42
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   315 (290)
PWM (Da):   %s   33326.94 (30665.5)  
PI (pH):   %s   9.14 (8.92) Peptide Signal:   %s   cut: 26 range:26-315
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MACESSSVKRAILLLLRFLLGTTSAELSSTLYSTSCPSALDTIKCGMSSVVSSKARMGVPLPRLYFHDCFINAHGLILLEYTANFAEKKNVSPNANXIQVFEVIDMIKSQLESTCPRXVSXAXXLVVXA*DSIVALSGPSWTISLRRRDSTSASQSAAISNIPAPSLNLSDLISSFSSKGFTTKEXAALLSHTIGQA*CLTFQAQLYNNQHRICNITESKLSELRRRQQPLSS*RHEPDVLRQCLLKNLQIQKDLLNSN*QLFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSSSQIRKNYGKVNSCSF

Retrieve as FASTA  
Remarks Pseudogene from genomic (several stops in frame). Scaffold_1_1028 (638..3575)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAATGCA
AGCCTCTCTGCTCTGAGTCCC
TCCTCTCTTTCCGATTGATTTTTACCTTTGTTTTTCTCTTTCATTCAAGCTGCGTGCAAGCGTGCATGCATGATGCATCTTCGTGCTTGTGCGTGTGAAGCATTCCAACCAACCACGTAG
TCAAAAGAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGCTGAGTCTGACACTTTTTGGTATTTTGTGGTGCCATGCATTTTTGTGAGTTTATTATA
TTATTAATAGATTTTGTTTGTTATAACAAAATAATNTTTTTGGTAAATGAAAAAAACTTTTTCATGAGTATCGTTAGTATACGCTGCCGGCGTAAAAATATTTTTTTACAAACGGGCTTA
TCCACCCTTAATTTGGCTGTTAGTGAGGGGTTTGGAATCTTCAAATCATGGATAAGAATGGTTATGTAAAGTTTTCTTTAGACCGATAGTGCACGCTTTAATTTTCTTATATTACAAAAA
ACGATGTTGTCGATCAGATGTATATGTGATTAACTACCTGGTTTAAATCCAATGAACTCGATGAATTGGATCACGTAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTTTATGGTAAA
TTATCATTTTTAATGAAATTTGTTAATCAAATGGTACTCTAAAATCTTATTAGATATTTGAACAAGCGAATCGCGNCTTGTGCATGGCCTCACTAGTTTGCTTCCACACAANTTTAGAGT
GTCAATCTAANTAAACCAATCAATTTAGTGTACCTACTTTGTTATNCTCTTCATCTTCTTTGTGCATAATTTTAGAGTAGTCTATATCCTAATGAGGGATAAGTACATTAAAAGTACCAA
AAGCTGTATACAANGCTCACTTTAGTGCTAAAAATTTTCGCCGGCTCACTTAAATGCCAAATCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAACGATCATCTAAGTTCCAACGACGAGAA
ATTCNAGCCAAATTGATTACGTCTCATTTATAATTAAAATTTTAATATGACTTGACAAATNTTTTAAAAACTCCAGTCCATGTGGCATTTTCACGTAGCATGCTTGGCACTGAAGTGATG
GCTTTTTAATAGCAACTAGTTCTAAAGTGATCACTTTAAACAAAATTTAGCATTTAAATGATCACTTTTTACAAATTTTGAACGACGTCGTTTATGTGTTATATGCTGACTAGGCACGTT
GGCGAGCCACGTAGGACTGAGAAATTAATAAAACACAATCACGTCNGATTTCTAGTAACCCAAACNNNAANTGACACTTAAAAGNTTNTTTTTTTTTTAAAAGTAGCACTTAAGTGATCT
AAAAAAANNTTTAACACTAAAGTGAGTATNNTACACAACTTTTGACANTTTTAGTATATTTATCCCTCCTAATGGAGCTTTCTCCATCAAACATGTCTCCATTTCAATCTCGACATTCAA
AGCCCGATTGGTTTTTTATGGATGCATTGTTCCTTCAGAGAAAACACGAAGCAAAGTCGNAAGGCACGAGAAAAGTTGGAGAACTTCCTATTTAGTGTCACCCCGTCAAAACTGGTGTCT
CTAGGCGTTCATGATGGGGACNAAAAGGTGGAAAAGGATAGGNGAAAAATTCAATGTCCGTACTCGATTTTCAGGAAAAATTATAGCCTTTAACCCGTTTGCAACCATTGAATTTAATGG
ACTCCAATCCCATCGATTTTCTATTTAGAAGGACTAATGTGTGGCGTAGATGCCACGGGTTGATTTTATTGGAGTACACCGCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCA
ATTNTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCCTNTGCCNACANATTGGTNGTTNCTGCNTGAGATTCCATCGTTGCCT
TAA
NTGCACATNTTCTTCTCAATTCTAGTGATCAATTGTGAGGANAAAAAAATCACATGTTATGTTCTCCATGCTATATTAATACTAACACATATGGATTTATTTTTTACTTAATTTTGA
GTTAGGTGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTC
CTTCTCTAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTAGGT
CATTGTCTTTNTTTTTTTCACCTATTAAAAAAGAATTTATAATAATGCCCGATCAATATACTGAGAACAAT
TTACCAAACATTGTTTGATTGTTTGTTAACAAAATCGCACACGATAGGTCAAGCCTGATGCTTGACTTTCCAGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAG
CAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGAA
CTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCT
CACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAACTCATGTTCGTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCTTGTGAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCAGCGCCCTC
GACACCATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAATGCA
CACGGGTTGATTTTATTGGAG
TACACCGCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCAATTNTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCC
TNTGCCNACANATTGGTNGTTNCTGCNTGAGATTCCATCGTTGCCTTAA
GTGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGC
AACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTCCTTCTCTAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTAGGT
TCGCACACGATAGGTCAAGCCTGATGC
TTGACTTTCCAGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGAC
GTCCTTCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGAACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCG
GCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAACTCATGTTCGTTC

Retrieve as FASTA