Entry information : EguPrx[P]46
Entry ID 11598
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguPrx[P]46
Name EguPrx[P]46
Class Class III peroxidase     [Orthogroup: Prx010]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]46
start..stop
S start..stop
EguPrx[P]42 588 0 1..313 4..315
EgrPrx[P]42 558 0 1..313 4..315
EgrPrx[P]46 528 0 1..313 1..313
EcamPrx[P]42 526 0 1..313 4..320
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 647..856 210 N° 2 2611..2796 186 N° 3 2919..3086 168 N° 4 3192..3566 375
join(647..856,2611..2796,2919..3086,3192..3566)


exon

Literature and cross-references EguPrx[P]46
Protein sequence: EguPrx[P]46
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   309 (287)
PWM (Da):   %s   32600.72 (30244.3)  
PI (pH):   %s   9.47 (9.07) Peptide Signal:   %s   cut: 23 range:23-309
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ESSSVKRAILLLLRFLLGTTSAELSSTLYSTSCPXSALDTIKCGMSSVVSSKARMGVPLPRLYFHDCFINCHGLILLEYTANFAEKKNVSPNANXIQVFEVIDMIKSQLESTCPRXVSXAXXLVVXA*DSIVELGGPSWTISLRRRDSTSASQSAAISNIPAPSLNLSDLISSFSSKGFTTKEXAALLKSHTIGQA*CLTFQAQLYNNQHRICNITESKLSELRRRQQPLSS*RHEPDVLRQCLLKNLQIQKDLLNSN*QLFSGGAIDFQGNAYSSNSATFMTDFSNAMVKMGNLNPLTGSSSQIRKNYGKVN

Retrieve as FASTA  
Remarks Pseudogene from genomic (Stops in frame, 5' end is missing). Scaffold_1_1028 (647..3563).
scaffold_1_1028 (647..3563)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCNNNAGCGCCCTCGACACC
ATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAAT
GCAAGCCTCTCTGCTCTGAGTCCCTCCTCT
CTTTCCGATTGATTTTTACCTTTGTTTTTCTCTTTCATTCAAGCTGCGTGCAAGCGTGCATGCATGATGCATCTTCGTGCTTGTGCGTGTGAAGCATTCCAACCAACCACGTAGTCAAAA
GAATTATTAGATTCGCGTCTACACAAGTTAGGTAGGAGGTTCACATATTGAATTAGCTGAGTCTGACACTTTTTGGTATTTTGTGGTGCCATGCATTTTTGTGAGTTTATTATATTATTA
ATAGATTTTGTTTGTTATAACAAAATAATNTTTTTGGTAAATGAAAAAAACTTTTTCATGAGTATCGTTAGTATACGCTGCCGGCGTAAAAATATTTTTTTACAAACGGGCTTATCCACC
CTTAATTTGGCTGTTAGTGAGGGGTTTGGAATCTTCAAATCATGGATAAGAATGGTTATGTAAAGTTTTCTTTAGACCGATAGTGCACGCTTTAATTTTCTTATATTACAAAAAACGATG
TTGTCGATCAGATGTATATGTGATTAACTACCTGGTTTAAATCCAATGAACTCGATGAATTGGATCACGTAAAGTCCTGAACGTTGGAGCTTAAAAATGATATTTTATGGTAAATTATCA
TTTTTAATGAAATTTGTTAATCAAATGGTACTCTAAAATCTTATTAGATATTTGAACAAGCGAATCGCGNCTTGTGCATGGCCTCACTAGTTTGCTTCCACACAANTTTAGAGTGTCAAT
CTAANTAAACCAATCAATTTAGTGTACCTACTTTGTTATNCTCTTCATCTTCTTTGTGCATAATTTTAGAGTAGTCTATATCCTAATGAGGGATAAGTACATTAAAAGTACCAAAAGCTG
TATACAANGCTCACTTTAGTGCTAAAAATTTTCGCCGGCTCACTTAAATGCCAAATCGGAAAAAAAAAAAAAAAAAAAAAAAAAAAACGATCATCTAAGTTCCAACGACGAGAAATTCNA
GCCAAATTGATTACGTCTCATTTATAATTAAAATTTTAATATGACTTGACAAATNTTTTAAAAACTCCAGTCCATGTGGCATTTTCACGTAGCATGCTTGGCACTGAAGTGATGGCTTTT
TAATAGCAACTAGTTCTAAAGTGATCACTTTAAACAAAATTTAGCATTTAAATGATCACTTTTTACAAATTTTGAACGACGTCGTTTATGTGTTATATGCTGACTAGGCACGTTGGCGAG
CCACGTAGGACTGAGAAATTAATAAAACACAATCACGTCNGATTTCTAGTAACCCAAACNNNAANTGACACTTAAAAGNTTNTTTTTTTTTTAAAAGTAGCACTTAAGTGATCTAAAAAA
ANNTTTAACACTAAAGTGAGTATNNTACACAACTTTTGACANTTTTAGTATATTTATCCCTCCTAATGGAGCTTTCTCCATCAAACATGTCTCCATTTCAATCTCGACATTCAAAGCCCG
ATTGGTTTTTTATGGATGCATTGTTCCTTCAGAGAAAACACGAAGCAAAGTCGNAAGGCACGAGAAAAGTTGGAGAACTTCCTATTTAGTGTCACCCCGTCAAAACTGGTGTCTCTAGGC
GTTCATGATGGGGACNAAAAGGTGGAAAAGGATAGGNGAAAAATTCAATGTCCGTACTCGATTTTCAGGAAAAATTATAGCCTTTAACCCGTTTGCAACCATTGAATTTAATGGACTCCA
ATCCCATCGATTTTCTATTTAGAAGGACTAATGTGTGGCGTAGATGCCACGGGTTGATTTTATTGGAGTACACCGCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCAATTNTA
TACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCCTNTGCCNACANATTGGTNGTTNCTGCNTGAGATTCCATCGTT
GCCTTAANTG
CACATNTTCTTCTCAATTCTAGTGATCAATTGTGAGGANAAAAAAATCACATGTTATGTTCTCCATGCTATATTAATACTAACACATATGGATTTATTTTTTACTTAATTTTGAGTTAGG
TGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATTCCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTCCTTCTC
TAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTA
GGTCATTGTCTTTNTTTTTTTCACCTATTAAAAAAGAATTTATAATAATGCCCGATCAATATACTGAGAACAATTTACCA
AACATTGTTTGATTGTTTGTTAACAAAATCGCACACGATAGGTCAAGCCTGATGCTTGACTTTCCAGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAGCAAACT
GTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTTCGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGAACTAGCA
ATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACTTTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGG
CTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAAC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
GAGAGCTCTTCTGTCAAACGCGCCATCTTATTGTTACTCCGTTTCCTTCTCGGAACAACCTCTGCTGAGCTGTCCAGTACTTTATACTCCACATCCTGCCCCNNNAGCGCCCTCGACACC
ATTAAATGCGGCATGAGCTCCGTGGTCTCGAGCAAGGCGCGCATGGGTGTGCCGCTGCCCCGCCTTTACTTCCACGATTGCTTCATCAAT
TGCCACGGGTTGATTTTATTGGAGTACACC
GCAAACTTCGCTGAGAAGAAGAATGTTAGCCCGAATGCCAATTNTATACAGGTATTCGAGGTGATTGATATGATCAAGTCCCAACTGGAGAGCACGTGCCCCAGGGNCGTNTCCTNTGCC
NACANATTGGTNGTTNCTGCNTGAGATTCCATCGTT
GAGTTAGGTGGCCCGAGTTGGACAATCTCACTTAGAAGAAGAGACTCAACCAGCGCAAGCCAAAGTGCTGCTATTAGCAACATT
CCTGCCCCAAGTTTGAACCTCAGCGACCTCATCTCTTCCTTCTCTAGCAAAGGCTTCACCACCAAAGAAATNGCGGCACTCTTA
AAATCGCACACGATAGGTCAAGCCTGATGCTTGACT
TTCCAGGCCCAACTTTACAATAATCAACACCGCATATGCAACATCACTGAAAGCAAACTGTCCGAGCTCCGTAGGCGACAACAACCCCTCTCCTCTTGACGTCACGAGCCCGACGTCCTT
CGACAATGCCTTCTCAAGAACTTGCAAATCCAAAAGGATCTTCTCAACTCGAACTAGCAATTGTTCAGTGGTGGTGCCATAGACTTTCAAGGGAATGCTTATAGCAGCAATTCGGCAACT
TTCATGACAGATTTTTCTAACGCTATGGTGAAGATGGGTAACCTCAACCCGCTCACCGGCTCAAGCAGTCAAATTAGGAAGAACTATGGAAAAGTCAAC

Retrieve as FASTA