Entry information : EguPrx[P]49
Entry ID 11599
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx[P]49
Name EguPrx[P]49
Class Class III peroxidase     [Orthogroup: Prx025]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]49
start..stop
S start..stop
EgrPrx[P]49 483 6e-176 1..252 1..252
EglPrx[P]49 347 1e-122 15..252 1..238
EgrPrx48 305 7e-105 4..252 75..322
EglPrx48 303 6e-104 4..252 75..322
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11203..11387 185 N° 2 12159..12726 568  
join(11203..11387,12159..12726)


exon

Literature and cross-references EguPrx[P]49
Protein sequence: EguPrx[P]49
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   250
PWM (Da):   %s   26501.57  
PI (pH):   %s   9.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MHPLIDSIAKKPSEKFTRPNFSVQRYDIIDEAKKIFKATCLSTVPYANIVTLATQDSVLLARLLAGGPSYNVPMRRRDGLVSYPNEVNLPRATFSVSEATQAFMTKGFFTFTVXGXLLDAHSVGAAHCSLFQDRLSNFQGTXGALDPTMD*SLVTKLKGICRNSTXNDPIAFLDQSTSFMADNSVCKQIMQKKGVLRID*ELTIPAPAXFLGXCQMRDXSFACAMVRLGNIQVPTGNXKEIRRNCRIFNK

Retrieve as FASTA  
Remarks Pseudogene from genomic (PS is missing, stop in frame).
scaffold_1_2076 (11203..12726)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCCCTCATCGACTCCATTGCTAAGAAGCCATCNGAGAAATTTACCAGGCCAAACTTCTCTGTACAACGATACGACATCATCGACGAAGCGAAGAAGATTTTCAAAGCTACGTGC
CTTTCGACNGTCCCTTATGCTAACATAGTCACGCTTGCAACTCAAGACTCTGTATTGCTCGCCCG
TAAACCTATCAAATTGGGTTTAAGACCCATATATGATCATNTTAAAAATAAATAG
GTCATAGATAGGTCATTTCAATTTTGTCGAGCCTTCCTTAAATGTGTTTAAAATTTTAAAGGTTAAAATAAATGGATCTAAATGGGTTGAGTTTATGACCAATTTCCGACCAAAGGCTCA
CATACACACTCTTTCCTCTTTAGCCTTACAAAATTAATTTTTAGAAAAATCAGATTATAATTATAATTATTTTTCTTTTTCTTATTTAGTATTTTTTTTTTTTCTTTCTTCTTCCTTCTT
CCATCTTCCTTTGATTATACTGACGGACCAGGTGATGGACAAGTTGCCGGACTCGAGAAAGGCCTCAGGCAATTGGCTGAAGAAGAAGGAATTTTTTTTCTTTTTTAAAATAAAAAATNA
TTTTTAAAAAATAATAAATTAATAAAATTTATTTACAAACATATTTTTTTTTTATTTTCTTGGAAATTTTTTTCCAAGAAACAAATGTAACCTCAATTATTTAAAAAAATTATAAAAAAT
GTCCATAAATTTGAATTGCACGAAAGTATTTTAGNAGTACCTTTTTTTTTGATAAAAAAATCATAAGAAACAAGATCTCCTAAATTTGGTTAAACTAGTTAGGTTAGGTATGGGTTGGGT
ATGGGTTAAGAAATTTGCATTATAATAAATGGGTCATAAAGGGGTTAAATGAGTCAATATGAATCGGACCATTTATGATCCAATCCAAACCCGACTTAAGTTACCGATTTAACAAGTTTA
CTCGCTGGAGGCCCTAGCTATAATGTCCCTATGAGAAGGCGAGACGGTCTGGTTTCATACCCGAACGAAGTGAATTTGCCGAGAGCCACATTCTCGGTATCTGAGGCGACACAAGCTTTC
ATGACAAAAGGGTTTTTTACGTTCACCGTAANGGGGNCTCTTTTGGACGCCCACTCCGTTGGAGCCGCTCACTGCAGCTTGTTCCAAGACCGCCTTTCGAATTTCCAAGGCACCTNNGGA
GCTCTGGATCCAACGATGGACTAGAGCTTGGTCACGAAGCTGAAGGGCATTTGCAGGAACTCAACGAGNAACGACCCTATCGCGTTTTTGGACCAGAGCACGTCGTTCATGGCGGATAAC
TCNGTCTGCAAACAAATTATGCAAAAGAAAGGGGTGTTACGAATCGACTAGGAGCTCACAATTCCTGCGCCAGCANCGTTTCTCGGTTNATGTCAGATGCGAGATNNGAGCTTCGCGTGT
GCGATGGTGAGGCTCGGAAATATTCAAGTTCCCACTGGGAATNCTAAAGAAATCAGGAGGAATTGCAGGATTTTCAATAAGCCC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGCATCCCCTCATCGACTCCATTGCTAAGAAGCCATCNGAGAAATTTACCAGGCCAAACTTCTCTGTACAACGATACGACATCATCGACGAAGCGAAGAAGATTTTCAAAGCTACGTGC
CTTTCGACNGTCCCTTATGCTAACATAGTCACGCTTGCAACTCAAGACTCTGTATTGCTCGCCCG
TTTACTCGCTGGAGGCCCTAGCTATAATGTCCCTATGAGAAGGCGAGACGGTCTG
GTTTCATACCCGAACGAAGTGAATTTGCCGAGAGCCACATTCTCGGTATCTGAGGCGACACAAGCTTTCATGACAAAAGGGTTTTTTACGTTCACCGTAANGGGGNCTCTTTTGGACGCC
CACTCCGTTGGAGCCGCTCACTGCAGCTTGTTCCAAGACCGCCTTTCGAATTTCCAAGGCACCTNNGGAGCTCTGGATCCAACGATGGACTAGAGCTTGGTCACGAAGCTGAAGGGCATT
TGCAGGAACTCAACGAGNAACGACCCTATCGCGTTTTTGGACCAGAGCACGTCGTTCATGGCGGATAACTCNGTCTGCAAACAAATTATGCAAAAGAAAGGGGTGTTACGAATCGACTAG
GAGCTCACAATTCCTGCGCCAGCANCGTTTCTCGGTTNATGTCAGATGCGAGATNNGAGCTTCGCGTGTGCGATGGTGAGGCTCGGAAATATTCAAGTTCCCACTGGGAATNCTAAAGAA
ATCAGGAGGAATTGCAGGATTTTCAATAAGCCC

Retrieve as FASTA