Entry information : EguPrx[P]80
Entry ID 11603
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-13 (Qiang Li)
Sequence status theoretical translation / pseudogene
Reviewer Christophe Dunand
Last annotation changes 2016-03-13 (Christophe Dunand)
Peroxidase information: EguPrx[P]80
Name EguPrx[P]80
Class Class III peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguPrx[P]80
start..stop
S start..stop
EgrPrx[P]80 163 5e-55 1..85 1..85
EglPrx[P]80 155 5e-52 1..85 1..85
EgrPrx[P]79 123 5e-38 3..85 79..154
EcamPrx[P]80 120 4e-37 3..75 91..156
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 567..569 3 N° 2 1566..1709 144 N° 3 2281..2391 111  
join(567..569,1566..1709,2281..2391)


exon

Literature and cross-references EguPrx[P]80
Protein sequence: EguPrx[P]80
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   85
PWM (Da):   %s   9246.81  
PI (pH):   %s   8.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MWKGCDGSILISSKPGSKELAEKDAIDNKDLRAEGFETIAKTKSFVKNKRYHSHPKCPGVVSCADILAIAARDFVQLVLPSTYRP*

Retrieve as FASTA  
Remarks Pseudogene from genomic.
scaffold_5_18005 (567..2391)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGCAAAACCAAGCATTTCAAAGTCAAATTTTTCTTTCTGCGTGAGGTGCAACAAAGTGGCGAAGTTAAGTTGGTCTATTGCAGATCTGAGGATCAGCTTGCAGATATGTTCACAAAAC
CACTTCAGGCTGGAACATTTGAGCTGTTAAGAGAGAAAATAGGAATTTACAGCAGCAACTGATCCAAGGAGGAGTTTGTTGGAATTGTTCAGCTGCTGTTTTCTGTAATATTTTCCTTTG
TTTTACTCTGTTTTTTTATTAAAAAACAGCCAAGTTCATTTAGTTATGCATTTAGTGTTTTTTGTTATTTTCTAGGAAGTTAATAGCACGTTTGTGTGCAGTTATGTGTTTCACATACGT
GAGCAGTTTTTGTTTTGTGTTTAGTAGCTGTACTTGACAGTTTCTTTAGAAAACTGACATACGCAAGTTTGTGCTCTGTTTTCTCTATGCTTTTCTTCCTCATTCAAAAACTATAGCTTC
TGATTTTATGTTTCTAGTTTACTGTTTTGATCAGTAACAACACTTTCACGTGCATGCAATAGCAGCAGAGGAAGTCAATATTCAGGCAGATGCTACTAGCGGTTGAGCAACTCCCCACAT
TTTGAGCATCTTTTGTTATCTACGGTGACCGCATCCTTGCATATTCTTGTTTCTACACAAATGAGTCCGTATACAACATCACTAATAAGAAATTACAGTTTTCATCAGTTAATCTTACCG
AAAATTCAATTCAACCCTCGGGTGAGTGTTTCGTGTTTTGTTATTATTGCATTCCCCGAGCCCGCCACAATTGACAATCAAAGTCGGCCAGGCATGGGTCCTGAGTCGATAATTCTCTTC
ATTTTCATAGCAAGCGAGAGAAATTACCACGAAAAACACGGAGAATCATCAACTAGCGAAAAAATTACTGCCGGCAAACGCGGCTCATTTGTTAATCAATCTAGTAGGACAATAATCTTA
GTGTAGAAACTACTGATTTTGCATGAGTTATGACTAAAGTGGAAGGGATGTGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTAGCCGAGAAGGACGCAATTGACAAC
AAAGATTTGAGAGCGGAGGGATTCGAGACAATCGCGAAAACCAAGTCCTTCGTGAAAAATAAG
GTGCTGCATGACAACATTTCTCATTCTCACAATTTTTGTTCTTTGGTTCTTCTGGAA
CAAAAAAAGAACAAAAACCCGTTTGGTAACGCCAAGTTGTTTTTATATTCCCTGGAATAGAAAGTTAGCCCGGGAATAGATTTGAAGCAGAAACGATAAGCAAAAAAAAATTGCTTCTGT
TCCCGAAATAATTTCTAGAAATAAGCTACTTTTCTTTTTTCTTTTTCTTTTATTCCTCTCTCTTGCCGCGGCCACCTCCGACCGCTCAGAGCCACTGCNNNNNNNNNNNNNNNNNNNNNN
NNNNNNNNNNGTCGTCGTCATCAACCGCCGCCACCGATCTCCGTTACCGAGCGGCGGTGGCAATCCGTGAACAAGAATAAAAAACGAATAAATACAAAAGAGAAATTGTTGCATTAGCAA
ACGCATTTCTATTCTTTTTTTATTCCAATAGTAGAAATTTTGTGTAGTTACCAAACGGATTCTTTTACTTAGAAATTGTTCCCCAAAATAGAAATAGAAAATAACTATTTCTGAAAAAAA
AAAAAAAAAAAANAANTCTTCTCCGGCCAAGAAGCGTTACCATTCGCACCCTAAATGCCCCGGCGTCGTTTCTTGTGCTGACATTCTCGCCATCGCTGCCAGAGACTTTGTCCAACTGGT
ACTTCCATCAACCTATCGTCCTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTGGAAGGGATGTGACGGGTCGATATTGATATCGAGCAAGCCCGGAAGCAAGGAGCTAGCCGAGAAGGACGCAATTGACAACAAAGATTTGAGAGCGGAGGGATTCGAGACAATCGCG
AAAACCAAGTCCTTCGTGAAAAATAAG
CGTTACCATTCGCACCCTAAATGCCCCGGCGTCGTTTCTTGTGCTGACATTCTCGCCATCGCTGCCAGAGACTTTGTCCAACTGGTACTTCCA
TCAACCTATCGTCCTTAG

Retrieve as FASTA