Entry information : EguRboh04
Entry ID 11607
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-19 (Christophe Dunand)
Peroxidase information: EguRboh04
Name EguRboh04
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh04
start..stop
S start..stop
EcamRboh04 1802 0 1..889 1..889
EgrRboh04 1801 0 1..889 1..889
EglRboh04 1799 0 1..889 1..889
PtRboh10 1430 0 1..889 1..886
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3947..4457 511 N° 2 4679..4838 160 N° 3 4952..5000 49 N° 4 5111..5224 114
N° 5 5392..5826 435 N° 6 5968..6354 387 N° 7 6455..6550 96 N° 8 6684..6799 116
N° 9 6909..7011 103 N° 10 7196..7269 74 N° 11 7412..7926 515 N° 12 8065..8174 110
join(3947..4457,4679..4838,4952..5000,5111..5224,5392..5826,5968..6354,6455..655 0,6684..6799,6909..7011,7196..7269,7412..7926,8065..8174)


exon

Literature and cross-references EguRboh04
Protein sequence: EguRboh04
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   889
PWM (Da):   %s   98462.32 Transmb domain:   %s   o340-359i480-502o522-544i704-721o
PI (pH):   %s   9.37
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MEIXDHHQHAQWSDTDSNCSSRLGYSGPLSSMSTKIRSNARFRDDQXEECXVEITLDVGXDSVSVHDXKGGGDPETALFTSRLGLRPSSLGAQLSFRLRQVSQELRRITSXKGRNNQXDRTRSGAARALRGLQFMTKNVEIDQGWSEVEARFDELAXNGVLPKSLFGQCIGMNESSEFASELXDALARRRGITSSAVSKPELREFWEQXADQSFDARLQTFFDMVDKNADGRITEEEVKIIAXSASANKLSKIQEQAEEYAALIMEELDPSNLGYIELHNLETLLLQAPIQSRSAHAGSESRVLSQMLSQKLVPTREHNPIKRYYKALAYFIEDNWKRIWVMGLWISICAGLFTWKFIQYKHRAVFDVMGYCVTTAKGGAETTKFNMALILLPVCRNTVTWLRSRTRLGVIVPFNDNINFHKVIAWGIAVGVGLHAGAHLTCDFPRLLXATDAEYEPMKQFFGEKRPNNYWWFVKGTEGWTGVSMLVLMTIAXTLAQPWFRRNRLDLPKXLKKLTGFXAFWYSHHLFVIVYVLFVIHGYFLYLAKKWYKRTTWMYLAVPVTLYASERLLRALRSGYKTVRIFKVAVYPGNVMALHMSKPQGFRYTSGQYIFVNCAAVSPFQWHPFSITSAPGXDYLSLHIRTVGDWTSQLKXVFSACXPPSIDQSGLLRADIATGENVPRIPRLLIDGPYGAPAQDYKXYDVLLLVGLGIGATPLISIVKDVLNNIKQQKEMEKGIVESGAKSNKRKPFLTRRAYFYWVTREQGSFEWFXGVMNEVAENDRDGVIELHNYCTSVYEEGDARSALIAMLQSLNHAKNGVDIVSGTRVRTHFARPNWRNVFKHVAVNHPDERGVFYCGVQGXVGEMRRLAQDFSHKTTTKFYFHKENF

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_8_30134 (3947..8174)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCCANGATCATCACCAGCATGCTCAGTGGTCTGACACAGACAGCAATTGTAGCTCCAGACTTGGTTATAGTGGCCCTCTGAGTAGCATGAGCACCAAGATCAGAAGCAATGCA
AGATTCAGGGACGACCAANATGAGGAATGCTANGTCGAGATCACGCTAGATGTNGGNGANGATAGCGTCTCGGTTCACGACATNAAGGGAGGAGGAGATCCTGAGACNGCATTGTTCACN
AGTCGCTTGGGGCTGCGGCCCTCGTCGCTCGGTGCACAGCTGTCGTTCAGGCTCAGACAAGTCTCACAAGAGCTCAGGCGAATCACCTCGNCGAAAGGGCGTAATAATCAGNTCGATAGG
ACTAGATCCGGTGCTGCACGGGCATTGCGTGGGCTCCAGTTTATGACCAAGAATGTCGAGATCGATCAAGGTTGGTCTGAGGTNGAAGCAAGGTTCGATGAATTGGCTNTTAATGGAGTT
CTTCCGAAATCACTCTTCGGCCAGTGTATAG
GTATGTCAACTGATTTTGCTAAAAAGAAATGCNAGAATCGAATACTTAATTCATATAAACAAATGTTAATTGTTTCAAACGNAAAGATC
TGCATTTATTACATTNTTTCATCTCAAGAATATTCTGTCAACTCATTTAGTCCTTCGATACATTTCTTAGATANTAGTGAACTTGCATTAAATTAGAGTAGCGGACTGACAAGGATCGTT
GCATCTGTTTAGGGATGAATGAATCCAGTGAGTTTGCCAGCGAGCTATTNGACGCGCTGGCACGACGGAGAGGCATAACATCGTCTGCAGTAAGCAAGCCTGAGCTACGGGAATTCTGGG
AACAGATNGCNGATCAAAGCTTCGATGCGAGGTTGCAAACCTTCTTCGATAT
GTAAGTTCACNTGCCCATTTCACTATAATAGCTTTCACNTTGAATCNACTAAAAATCNGGTTTACTTG
GGACTTATTCAGACANATCCANTGAGNAGTNATTTAATGATGCAGGGTAGACAAAAATGCAGATGGTCGGATCACCGAGGAAGAGGTGAAAGAGGTAAGAGATGGTCAAGAAAAGAATAT
GATGATGATGATGATGAGAAATGATTCAATGTGAGAGAATAATTAATAAGTTACTAATTGTGATCATATCATTGTCAACATCAGATAATTGCANTAAGCGCTTCAGCGAATAAGCTGTCA
AAGATCCAAGAACAAGCTGAGGAATATGCAGCCTTGATCATGGAAGAGTTGGATCCTAGTAATCTGGGATACATTGAG
GTACATGTTCAGATCCAAACCTTCNACTTTTTTAAATGATTG
TTGACCACATGACCCACGTACCGTGCTTACTAATATTCAATTACTTATCTAAGATATTGCCTTGATTTAAAAGTCTAAATTGAGTCAAGTACCTGAGAAGAGCATCTGCTGAACTCCTGT
TTTAGCTACACAACCTGGAGACACTCCTCTTGCAAGCCCCGATCCAATCAAGGTCGGCCCACGCCGGGTCCGAGAGCCGGGTCCTGAGCCAGATGCTGAGCCAGAAGCTGGTCCCAACCA
GAGAGCACAACCCCATCAAGAGATACTACAAGGCACTGGCCTACTTCATTGAGGACAATTGGAAGAGGATTTGGGTCATGGGCCTATGGATCTCAATCTGTGCAGGCCTGTTCACTTGGA
AGTTCATCCAGTACAAGCACAGAGCTGTGTTTGATGTGATGGGCTACTGTGTGACCACAGCTAAAGGTGGAGCTGAGACTACCAAGTTCAACATGGCCCTGATTTTGCTTCCAGTTTGCA
GAAACACAGTCACTTGGCTGAGGAGTAGAACCAGGTTGGGTGTGATTGTTCCCTTCAATGACAACATCAATTTCCACAAG
GTATGAACATATTATGCNGCNATAAATTTAGTTGAAAAGT
GTATTTGGATATGCNTTGAAGGAAAAATNNAAAGAGAACATAATTTACTTCANTNAGCACTNAATCTAATTATAAGCGTTAAATGTATGTGGCCTAAATAGGTGATAGCTTGGGGCATTG
CGGTTGGGGTTGGTCTACATGCCGGAGCCCATCTGACCTGCGACTTCCCTAGGCTGCTCCANGCCACCGATGCTGAATACGAGCCAATGAAGCAGTTCTTCGGCGAGAAGCGCCCCAATA
ACTACTGGTGGTTCGTGAAAGGGACTGAGGGCTGGACCGGTGTGTCCATGCTGGTGCTGATGACCATAGCATANACCTTAGCCCAGCCCTGGTTCCGCCGCAACCGGCTGGACCTCCCCA
AGNCCCTCAAAAAGCTCACCGGGTTCAANGCTTTTTGGTACTCGCACCACCTCTTTGTGATCGTCTACGTGCTCTTCGTGATACACGGCTACTTCTTGTATTTAGCCAAGAAGTGGTACA
AGAGAACG
GTGAGTGATAATCTACATCACATTGCTTGGTAATTAATGANATTTTTACNGTTTGTCCAATATCACATTTCTAACTATGTCTACGAACTCGTTTGCGCAGACCTGGATGTAT
CTTGCAGTACCAGTCACATTATATGCGTCCGAGCGCTTGCTCCGTGCGCTCAGGTCTGGGTACAAGACCGTGCGGATCTTCAAG
GTGAGGCTCGGATTCGATTAAGAGTTGTTCTGTTTT
GAAACACTGCAGAATAGTTGTCCAGACTGATGTTTTAAAACACGAGGCATTCACAATCACAATAACTGAGTTGGGGTCATATTCTGGTGCGTNTCAGGTTGCAGTTTATCCAGGAAATGT
CATGGCTCTGCACATGTCTAAGCCTCAAGGCTTCAGATACACAAGCGGTCAATACATTTTTGTGAACTGTGCAGCTGTTTCTCCATTCCAATG
GTAACTTTTATTTTNTAACAAAAAAGA
CAGGAAAATGATTACTTCTGTACNTTACTTGTATTAGCCATTGAAAAGGAACTTGGCTAACTGGTCAATTGAACATNATCAGGCATCCATTTTCGATCACCTCAGCACCCGGCGANGATT
ACTTAAGCCTTCATATACGCACCGTGGGCGACTGGACATCTCAGCTTAAANCTGTATTCTCGAAG
GTGATTGTTCGAGTTTATTTCTAAGTAACTTTGCGACATACTTGGTCCTGCCTAT
TGGCAACCGATTGTGAGAAATNTTCTGAACTTAAGTAAGGTCCGCATCAGTCTAATTACGACATNCTGTCGTATGGATGTATATGCTNTTTAAAAACATGACGAAAAGTCACNTTNTGAA
TGTGTGTAGGCATGTCANCCTCCATCAATTGATCAAAGTGGACTTCTAAGAGCAGATATCGCAACAGGAGAAAATGTGCCCAGGTAATTAGACTTGTTNGCGCAGCTCATGGTCTGCTCG
GCTTGCTAGGCTTGAAGTCTAGATGAGTAGTTTCAGGGAACACGAACATAGCGTATACAGTTTTTCGTAGAATGGGCAAGCTAANTGGATATCATTTTCATCTAGGATTCCGAGGCTCTT
GATCGACGGTCCATATGGTGCTCCAGCACAAGACTACAAGAANTACGACGTGCTTCTCCTAGTCGGGCTTGGCATCGGTGCGACACCATTGATCAGCATCGTCAAGGATGTNCTCAACAA
CATCAAGCAGCAGAAAGAGATGGAAAAGGGCATCGTAGAGAGCGGCGCCAAGAGCAACAAGCGAAAGCCNTTCCTGACCCGGCGGGCCTACTTCTACTGGGTCACCCGTGAGCAGGGCTC
GTTCGAGTGGTTCANAGGCGTGATGAACGAGGTCGCCGAGAACGACAGGGACGGCGTGATCGAGCTCCACAACTACTGCACCAGCGTGTACGAGGAGGGCGACGCCCGGTCGGCCCTGAT
CGCGATGCTCCAGTCCCTGAACCACGCCAAGAACGGGGTCGACATCGTGTCGGGCACCCGGGTACGGACGCACTTCGCNAGGCCCAACTGGCGCAACGTCTTCAAGCACGTCGCGGTCAA
CCACCCCGACGAAAGAGTTG
GTGAGCATNCTAAAGCACGTCTAGCACATATTTTCCAGGAAGCATAGACATAATTCACTCNAATAAATGATTAATTATCACATTTTCAGCATCTAGTCGT
GAGTNGACTAATGTCAAGATGTTTCCTTTCTTCTACAGGAGTGTTTTATTGTGGTGTACAAGGGGNGGTTGGGGAGATGAGGAGGTTGGCTCAGGACTTCTCCCACAAGACNACCACCAA
GTTCTATTTCCACAAAGAGAACTTTTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGAGATCCANGATCATCACCAGCATGCTCAGTGGTCTGACACAGACAGCAATTGTAGCTCCAGACTTGGTTATAGTGGCCCTCTGAGTAGCATGAGCACCAAGATCAGAAGCAATGCA
AGATTCAGGGACGACCAANATGAGGAATGCTANGTCGAGATCACGCTAGATGTNGGNGANGATAGCGTCTCGGTTCACGACATNAAGGGAGGAGGAGATCCTGAGACNGCATTGTTCACN
AGTCGCTTGGGGCTGCGGCCCTCGTCGCTCGGTGCACAGCTGTCGTTCAGGCTCAGACAAGTCTCACAAGAGCTCAGGCGAATCACCTCGNCGAAAGGGCGTAATAATCAGNTCGATAGG
ACTAGATCCGGTGCTGCACGGGCATTGCGTGGGCTCCAGTTTATGACCAAGAATGTCGAGATCGATCAAGGTTGGTCTGAGGTNGAAGCAAGGTTCGATGAATTGGCTNTTAATGGAGTT
CTTCCGAAATCACTCTTCGGCCAGTGTATAG
GGATGAATGAATCCAGTGAGTTTGCCAGCGAGCTATTNGACGCGCTGGCACGACGGAGAGGCATAACATCGTCTGCAGTAAGCAAGCCT
GAGCTACGGGAATTCTGGGAACAGATNGCNGATCAAAGCTTCGATGCGAGGTTGCAAACCTTCTTCGATAT
GGTAGACAAAAATGCAGATGGTCGGATCACCGAGGAAGAGGTGAAAGAG
ATAATTGCANTAAGCGCTTCAGCGAATAAGCTGTCAAAGATCCAAGAACAAGCTGAGGAATATGCAGCCTTGATCATGGAAGAGTTGGATCCTAGTAATCTGGGATACATTGAGCTACAC
AACCTGGAGACACTCCTCTTGCAAGCCCCGATCCAATCAAGGTCGGCCCACGCCGGGTCCGAGAGCCGGGTCCTGAGCCAGATGCTGAGCCAGAAGCTGGTCCCAACCAGAGAGCACAAC
CCCATCAAGAGATACTACAAGGCACTGGCCTACTTCATTGAGGACAATTGGAAGAGGATTTGGGTCATGGGCCTATGGATCTCAATCTGTGCAGGCCTGTTCACTTGGAAGTTCATCCAG
TACAAGCACAGAGCTGTGTTTGATGTGATGGGCTACTGTGTGACCACAGCTAAAGGTGGAGCTGAGACTACCAAGTTCAACATGGCCCTGATTTTGCTTCCAGTTTGCAGAAACACAGTC
ACTTGGCTGAGGAGTAGAACCAGGTTGGGTGTGATTGTTCCCTTCAATGACAACATCAATTTCCACAAG
GTGATAGCTTGGGGCATTGCGGTTGGGGTTGGTCTACATGCCGGAGCCCAT
CTGACCTGCGACTTCCCTAGGCTGCTCCANGCCACCGATGCTGAATACGAGCCAATGAAGCAGTTCTTCGGCGAGAAGCGCCCCAATAACTACTGGTGGTTCGTGAAAGGGACTGAGGGC
TGGACCGGTGTGTCCATGCTGGTGCTGATGACCATAGCATANACCTTAGCCCAGCCCTGGTTCCGCCGCAACCGGCTGGACCTCCCCAAGNCCCTCAAAAAGCTCACCGGGTTCAANGCT
TTTTGGTACTCGCACCACCTCTTTGTGATCGTCTACGTGCTCTTCGTGATACACGGCTACTTCTTGTATTTAGCCAAGAAGTGGTACAAGAGAACG
ACCTGGATGTATCTTGCAGTACCA
GTCACATTATATGCGTCCGAGCGCTTGCTCCGTGCGCTCAGGTCTGGGTACAAGACCGTGCGGATCTTCAAG
GTTGCAGTTTATCCAGGAAATGTCATGGCTCTGCACATGTCTAAGCCT
CAAGGCTTCAGATACACAAGCGGTCAATACATTTTTGTGAACTGTGCAGCTGTTTCTCCATTCCAATG
GCATCCATTTTCGATCACCTCAGCACCCGGCGANGATTACTTAAGCCTTCAT
ATACGCACCGTGGGCGACTGGACATCTCAGCTTAAANCTGTATTCTCGAAG
GCATGTCANCCTCCATCAATTGATCAAAGTGGACTTCTAAGAGCAGATATCGCAACAGGAGAAAATGTG
CCCAG
GATTCCGAGGCTCTTGATCGACGGTCCATATGGTGCTCCAGCACAAGACTACAAGAANTACGACGTGCTTCTCCTAGTCGGGCTTGGCATCGGTGCGACACCATTGATCAGCATC
GTCAAGGATGTNCTCAACAACATCAAGCAGCAGAAAGAGATGGAAAAGGGCATCGTAGAGAGCGGCGCCAAGAGCAACAAGCGAAAGCCNTTCCTGACCCGGCGGGCCTACTTCTACTGG
GTCACCCGTGAGCAGGGCTCGTTCGAGTGGTTCANAGGCGTGATGAACGAGGTCGCCGAGAACGACAGGGACGGCGTGATCGAGCTCCACAACTACTGCACCAGCGTGTACGAGGAGGGC
GACGCCCGGTCGGCCCTGATCGCGATGCTCCAGTCCCTGAACCACGCCAAGAACGGGGTCGACATCGTGTCGGGCACCCGGGTACGGACGCACTTCGCNAGGCCCAACTGGCGCAACGTC
TTCAAGCACGTCGCGGTCAACCACCCCGACGAAAGAGTTG
GAGTGTTTTATTGTGGTGTACAAGGGGNGGTTGGGGAGATGAGGAGGTTGGCTCAGGACTTCTCCCACAAGACNACCACC
AAGTTCTATTTCCACAAAGAGAACTTTTAG

Retrieve as FASTA