Entry information : EguRboh05
Entry ID 11608
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-03-13 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-04-07 (Christophe Dunand)
Peroxidase information: EguRboh05
Name EguRboh05
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh05
start..stop
S start..stop
EgrRboh05 1981 0 1..967 1..967
EglRboh05 1820 0 1..967 1..940
PtRboh04 1435 0 19..967 14..926
VvRboh03 1422 0 18..967 5..924
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 25950..26631 682 N° 2 25664..25826 163 N° 3 25484..25532 49 N° 4 25228..25341 114
N° 5 24619..25044 426 N° 6 23908..24294 387 N° 7 23704..23799 96 N° 8 23434..23549 116
N° 9 23217..23319 103 N° 10 23037..23110 74 N° 11 21944..22527 584 N° 12 21704..21813 110
complement(join(21704..21813,21944..22527,23037..23110,23217..23319,23434..23549 ,23704..23799,23908..24294,24619..25044,25228..25341,25484..25532,25664..25826,2 5950..26631))


exon

Literature and cross-references EguRboh05
Protein sequence: EguRboh05
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   967
PWM (Da):   %s   106314.29 Transmb domain:   %s   o395-414i535-557o577-599i759-776o
PI (pH):   %s   9.42
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MRNEEIGMGTFNYSSDNNNSSDTESVGSDGRXAFSGPLGSALRSSKRGSRKSARFNIPAETAGLRSAGATSKDEQEDGDPYVEITLDIRDDGVAVHSVQAAGGATNFEDPELALLAKRTFETGRSSSFGSSVFRSTSSRFRQVSQELKRIASLTRRPTAPPARRFDRTRSAAAHALKGLKFIAAKTGGGGGGAGSAASGWPSVEKKFDQLTASSGGLLHCSQFCECIGMNKESKEFATELFRALAQRRNIFGDSITKDQLKEFWDQISDESFDSRLQTFFDMVDKDADGRIAEEEVRIITLSASANKLSNIQKQADEYAALIMEELDPDNKGYIMVQNLETLLLQAPNQSXRXGDSKVLSQLLSQKLKPTIDXNPVRRWCEHAKYFLMDNWKRLWVMVLWIAIMAGLFTYKFIQYRNRAAFGVMGYCVCVAKGGAETVKFNMALILLPVCRNTITWLRXKTRLSVAVPFDDNLNFHKVIAAGIAVGVGLHVISHLTCDFPRLLLASPEAYEPMKPYFGEEQPPNYWWFVKGVEGVTGILMLVLMXIAFTLAMPWFRRSKINVPGPLKKLTGFNAFWYSHHLFVIVYTLLIVHGIKLYLAHXWYKKTXWMYLAVPVTLYACERLIRAFRSSIKPVKILKVAVYPGNVLALHMXKPHGFKYRSGQYMFVNCSAVSPFEWHPFSITSSPGDDYLSVHIRTLGDWTRQLKSVFSVCQPPXVGKSGLLRADCVPGGSIPRFPKILIDGPYGAPAQDYQXYEVVLLVGLGIGATPMVSIVKDIINNIKVKENEQDHXGSLESGGRPVSPLTPDDSNSHYPKAGHRSSHGRGAFKTRKAYFYWVTREQGSFEWFKGIMDEVAGMDERQVIELHNYCTSVFEEGDARSALIAMLQTLNXAKHGVDVVSGTRVMSHFAKPNWRQVYKKIALHHPDKRGVFYCGAPALTKELNHLALDFSRKTSTKFDFHKENF

Retrieve as FASTA  
Remarks Complete sequence from genomic. Scaffold_10_34472 (26631..21704)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAACGAAGAGATTGGGATGGGAACTTTTAACTATTCATCGGATAACAACAATAGTTCCGACACGGAAAGCGTCGGCAGCGACGGCCGCANAGCCTTCAGCGGGCCGCTCGGATCG
GCCCTTCGCAGCTCCAAGCGAGGCTCAAGAAAGAGCGCGAGATTCAACATCCCTGCGGAGACGGCGGGGCTCCGGAGTGCCGGCGCCACCTCGAAAGACGAGCAGGAAGATGGCGACCCG
TACGTCGAGATCACCCTCGACATACGGGACGACGGCGTCGCCGTCCACAGCGTGCAGGCCGCCGGCGGGGCGACCAACTTCGAGGACCCCGAGCTGGCGCTGCTCGCGAAGAGGACGTTC
GAGACCGGGAGGTCGTCGTCGTTTGGGTCGTCGGTCTTCCGGAGCACCTCGTCCCGTTTCCGGCAGGTCTCGCAGGAGCTGAAGCGCATCGCCTCCCTGACGCGGCGGCCGACGGCACCA
CCGGCGAGGCGCTTCGACCGGACGAGGTCGGCAGCGGCGCACGCGCTCAAGGGCCTCAAGTTCATAGCCGCCAAGACGGGCGGCGGCGGCGGCGGCGCTGGCTCCGCCGCCTCTGGGTGG
CCGTCGGTCGAGAAGAAATTCGACCAGTTGACCGCTTCGTCCGGCGGCCTCCTGCATTGTTCCCAGTTCTGTGAATGCATAG
GTAAATTAAAAATCCTGAAAATTACTCCTTTTTTATTT
TTATTTTTTGGGTTATTGCACTATAATTTGGTACCTCCTTTACAGCTCAATAATGTCCATTACGTCTGTAAATAATTGCAATTAGGAATGAACAAAGAGTCTAAGGAATTTGCGACCGAG
CTCTTTCGAGCACTCGCGCAGAGGCGCAACATATTTGGCGACTCCATCACCAAGGATCAGCTCAAGGAATTCTGGGACCAAATTAGCGACGAGAGCTTCGACTCGAGGCTGCAAACTTTC
TTCGACAT
GTAAGCAAGCAAAACGCTCTCGGCTAGTCTTAGATTTTATTTCCGTGTAGGTATTGAATAAGTTAATGTTANTATAAAAAGTTTTCTTGATTATTAAAAGCGAAATGGTTGG
TGGTGCAATAAAATGTTAGGGTGGACAAAGACGCGGATGGGAGAATCGCGGAGGAAGAAGTCAGAGAGGTATATAATTTTTTTCTCCCGTTCTTTGAAATANGTTGAAGGATTATGATTT
TTTTTTCTGNGAGTTAATTAATAAAAAGAAGTTGTCTGGACGTAGAATTGTTTAATTGTGTTGAAAGAGAATAAATCCTTGGTTTTGCAGATCATCACCCTGAGCGCATCGGCGAATAAG
CTGTCAAATATCCAGAAGCAAGCCGACGAATATGCAGCTCTCATCATGGAGGAATTGGACCCTGATAATAAGGGATACATCATG
GTATATATATATCATTAAACAATCGTTTATGTAATT
TGGACAAAAATTTGCAATTTTTACGAAATTTAACGTAGTCATCATCGGTATTAAATTAGGATCGCTATTGGAAAATGAGCTTTTTCACTAGCCACGNCTATGAAATAGCCATCCATGTGT
AACACGTTCTTGATTTGCCCTACACAGGTTCAGAACCTGGAAACACTGCTCTTGCAAGCTCCGAACCAGTCCNTGAGANTCGGAGACAGCAAAGTCCTGAGCCAGCTACTGAGCCAGAAG
CTCAAACCGACCATCGACAANAACCCAGTCCGCCGATGGTGTGAGCACGCCAAGTACTTCCTGATGGACAACTGGAAGAGGCTGTGGGTCATGGTGCTGTGGATTGCGATCATGGCGGGC
CTCTTCACCTACAAGTTCATCCAGTACCGGAACAGGGCGGCATTCGGCGTGATGGGCTACTGCGTCTGTGTTGCCAAGGGCGGTGCCGAGACAGTCAAGTTCAACATGGCCCTCATCCTG
TTGCCCGTTTGTCGAAACACCATCACATGGCTTAGGAANAAGACCCGGTTGAGTGTTGCGGTCCCCTTCGACGACAACCTTAACTTTCACAAG
GTAATACGGCAGCGAGNTGCTTTTATT
TCCNTTGTTTTTATTACTGAGAATATCATTAATCTAATGAAATGAGANACTCCACATAAGAATACTCATATAATTAAGCAATGGAAATATTTTGGGTATTATCTACTATTGTGTGTGATG
AAGTATACAATGAAATGTCAAGATTTTGCTTGCAATTCATACNCACATTTTGCTAATTGTAAATTACTATATCTTGTTAACTTCATCTGACTTTTGTTGCTCAAAATAATCTCGACTCCG
AGATCTTGATGAATAACTTGATCTAATATCATATTCCCTATATGTGTACAATTCCAGGTGATCGCGGCAGGGATAGCTGTCGGGGTCGGGTTGCATGTAATCTCGCATTTGACGTGCGAC
TTCCCAAGGCTCCTACTCGCGAGCCCCGAGGCGTACGAGCCCATGAAGCCCTACTTCGGCGAGGAGCAGCCCCCGAACTACTGGTGGTTCGTGAAAGGAGTGGAGGGCGTGACGGGGATC
CTGATGCTGGTTCTGATGGNGATCGCCTTCACGCTGGCCATGCCGTGGTTCAGGAGGAGCAAGATCAACGTGCCCGGGCCCTTGAAGAAGCTCACGGGCTTCAACGCCTTCTGGTACTCG
CACCACCTCTTCGTCATCGTCTACACGCTGCTCATCGTCCACGGGATCAAGCTCTACCTCGCCCACGANTGGTACAAGAAGACG
GTAAGCTTCCTNCTCCCTCCTTCCAATTACTACAAA
TCTAGNCANAATTGTTGCTTCCAAGGCTATTCTTCNCTCTTTAATCACTGTTTCTTTTGACTATAATCGCAGNNATGGATGTACTTGGCAGTGCCGGTGACCCTCTATGCGTGTGAAAGG
TTGATCCGGGCTTTCAGGTCCAGCATCAAGCCGGTGAAGATTCTCAAG
GTTATTATAATATAAACGCTGAACCAAACGGCCATATTTAATCTGCATAGTTCTGATCATCGTCATNTGGAG
CATATAATTAACGAATAAACTATTCATCTGCCGATGAAGATGTCATGAATGTTGAATTAAAATTTGATGGGCATTCATGCAGGTGGCGGTTTACCCGGGGAATGTACTGGCACTGCACAT
GTNGAAGCCCCATGGGTTCAAGTACAGAAGTGGGCAGTACATGTTCGTAAACTGCTCGGCTGTTTCTCCCTTTGAATG
GTATATCTATCTCTCTGTCTCTATCTATCTCTCTGTCTCATA
TGACATTTGTGATGATCCACGATGTTTGAGCAATCATTGCTAGAGAAGATGCTAACGTTTAATTATGAGCAGGCACCCTTTCTCGATCACTTCGTCCCCAGGAGACGACTACCTCAGCGT
CCACATTCGGACATTGGGAGATTGGACAAGGCAACTGAAAAGCGTATTCTCGGAG
GTTGGTTTGATCGACTGATTAATCATGGCTAGTGGGGGATTCATAGTTCCAGAATTTCTGCGAGC
CATTTGTTTATTGATTTGTTCTCCATTTTATGGATTGGTAGGTATGCCAACCTCCANCCGTCGGGAAGAGCGGACTGCTGAGAGCTGATTGCGTTCCAGGAGGAAGCATCCCACGGTAAG
ACTTTTTTCCTCGGTTGCACTAACTTCAAAGAAAACAAACATTTTGATCTTGAAATAATCAACCGATTTNCCGAGATATACGGTGATCACACGGTGAGAAATTTGCCCAAAAGGCGTAAT
GATGGAATTGAAAATTGAACNTTTTCAATTCTTGATAGAGTTATCTTANNGATGGTGGTTAAGGTTTACAAAAGTCAAGCCTCCGAACAATAGGAAACGACGCGTGGTCTAGCGAAATCC
CNNNNNACAAATAAAAAAACATACCAAATCCGTGATAGATTAAAAAGACATAGAACAAGACGGGNATGAACAAGACCCTAAAGTCCCGGTTGGTTTTATCCTATTTTCCTTTTGAGGCGT
CATCAATCATTGTTGGAGAAGATAGTTAAATCATCAATTTCAAACATGTATTATTAATGTTATTATNNNNNNNNNCAATCAAACATGTATTATTGAATGCTTAGCAGATCCATGATTGAT
TGTCCTTTTCCCAATGCGTTACAGCTTCCCAAAGATACTGATAGACGGTCCATACGGAGCNCCAGCACAAGACTACCAAAANTATGAGGTAGTGCTCCTGGTGGGGCTAGGGATCGGCGC
CACGCCCATGGTGAGCATCGTGAAGGACATCATCAACAACATAAAAGTCAAAGAAAACGAGCAAGACCACNTGGGCTCGTTGGAGAGTGGAGGACGACCCGTCTCGCCACTAACCCCGGA
CGACAGCAACAGCCACTATCCCAAGGCGGGCCACAGGAGCAGCCATGGCAGAGGAGCGTTCAAGACCAGGAAGGCCTACTTCTACTGGGTGACCCGGGAGCAGGGCTCGTTCGAGTGGTT
CAAGGGGATCATGGATGAGGTGGCCGGGATGGACGAGCGGCAGGTCATCGAGCTCCACAACTACTGCACGAGCGTGTTCGAGGAGGGCGACGCCCGGTCGGCCCTCATCGCGATGCTCCA
GACCCTCAACCANGCGAAGCACGGGGTCGACGTCGTGTCCGGGACCCGGGTCATGTCCCACTTCGCCAAGCCCAACTGGCGCCAGGTCTACAAGAAGATCGCGCTGCACCACCCCGACAA
GCGAGTTG
GTGGGTCCCCGCTTAACCTAACCCCCGCGCCCGCCGTGTCTTTAGTGATTCTGCTTGATTCGAACGATTTGTCACATCTATTTTTGTTATGCATGCGTTGTTGATTTGGCCA
CGATGAACAATTTTGCAGGAGTCTTCTATTGTGGGGCGCCGGCGTTGACAAAGGAGTTAAATCACTTGGCTCTGGATTTCTCTCGCAAGACATCCACCAAGTTCGACTTCCATAAGGAGA
ACTTTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAGAAACGAAGAGATTGGGATGGGAACTTTTAACTATTCATCGGATAACAACAATAGTTCCGACACGGAAAGCGTCGGCAGCGACGGCCGCANAGCCTTCAGCGGGCCGCTCGGATCG
GCCCTTCGCAGCTCCAAGCGAGGCTCAAGAAAGAGCGCGAGATTCAACATCCCTGCGGAGACGGCGGGGCTCCGGAGTGCCGGCGCCACCTCGAAAGACGAGCAGGAAGATGGCGACCCG
TACGTCGAGATCACCCTCGACATACGGGACGACGGCGTCGCCGTCCACAGCGTGCAGGCCGCCGGCGGGGCGACCAACTTCGAGGACCCCGAGCTGGCGCTGCTCGCGAAGAGGACGTTC
GAGACCGGGAGGTCGTCGTCGTTTGGGTCGTCGGTCTTCCGGAGCACCTCGTCCCGTTTCCGGCAGGTCTCGCAGGAGCTGAAGCGCATCGCCTCCCTGACGCGGCGGCCGACGGCACCA
CCGGCGAGGCGCTTCGACCGGACGAGGTCGGCAGCGGCGCACGCGCTCAAGGGCCTCAAGTTCATAGCCGCCAAGACGGGCGGCGGCGGCGGCGGCGCTGGCTCCGCCGCCTCTGGGTGG
CCGTCGGTCGAGAAGAAATTCGACCAGTTGACCGCTTCGTCCGGCGGCCTCCTGCATTGTTCCCAGTTCTGTGAATGCATAG
GAATGAACAAAGAGTCTAAGGAATTTGCGACCGAGCTC
TTTCGAGCACTCGCGCAGAGGCGCAACATATTTGGCGACTCCATCACCAAGGATCAGCTCAAGGAATTCTGGGACCAAATTAGCGACGAGAGCTTCGACTCGAGGCTGCAAACTTTCTTC
GACAT
GGTGGACAAAGACGCGGATGGGAGAATCGCGGAGGAAGAAGTCAGAGAGATCATCACCCTGAGCGCATCGGCGAATAAGCTGTCAAATATCCAGAAGCAAGCCGACGAATATGCA
GCTCTCATCATGGAGGAATTGGACCCTGATAATAAGGGATACATCATG
GTTCAGAACCTGGAAACACTGCTCTTGCAAGCTCCGAACCAGTCCNTGAGANTCGGAGACAGCAAAGTCCTG
AGCCAGCTACTGAGCCAGAAGCTCAAACCGACCATCGACAANAACCCAGTCCGCCGATGGTGTGAGCACGCCAAGTACTTCCTGATGGACAACTGGAAGAGGCTGTGGGTCATGGTGCTG
TGGATTGCGATCATGGCGGGCCTCTTCACCTACAAGTTCATCCAGTACCGGAACAGGGCGGCATTCGGCGTGATGGGCTACTGCGTCTGTGTTGCCAAGGGCGGTGCCGAGACAGTCAAG
TTCAACATGGCCCTCATCCTGTTGCCCGTTTGTCGAAACACCATCACATGGCTTAGGAANAAGACCCGGTTGAGTGTTGCGGTCCCCTTCGACGACAACCTTAACTTTCACAAG
GTGATC
GCGGCAGGGATAGCTGTCGGGGTCGGGTTGCATGTAATCTCGCATTTGACGTGCGACTTCCCAAGGCTCCTACTCGCGAGCCCCGAGGCGTACGAGCCCATGAAGCCCTACTTCGGCGAG
GAGCAGCCCCCGAACTACTGGTGGTTCGTGAAAGGAGTGGAGGGCGTGACGGGGATCCTGATGCTGGTTCTGATGGNGATCGCCTTCACGCTGGCCATGCCGTGGTTCAGGAGGAGCAAG
ATCAACGTGCCCGGGCCCTTGAAGAAGCTCACGGGCTTCAACGCCTTCTGGTACTCGCACCACCTCTTCGTCATCGTCTACACGCTGCTCATCGTCCACGGGATCAAGCTCTACCTCGCC
CACGANTGGTACAAGAAGACG
NNATGGATGTACTTGGCAGTGCCGGTGACCCTCTATGCGTGTGAAAGGTTGATCCGGGCTTTCAGGTCCAGCATCAAGCCGGTGAAGATTCTCAAGGTG
GCGGTTTACCCGGGGAATGTACTGGCACTGCACATGTNGAAGCCCCATGGGTTCAAGTACAGAAGTGGGCAGTACATGTTCGTAAACTGCTCGGCTGTTTCTCCCTTTGAATG
GCACCCT
TTCTCGATCACTTCGTCCCCAGGAGACGACTACCTCAGCGTCCACATTCGGACATTGGGAGATTGGACAAGGCAACTGAAAAGCGTATTCTCGGAG
GTATGCCAACCTCCANCCGTCGGG
AAGAGCGGACTGCTGAGAGCTGATTGCGTTCCAGGAGGAAGCATCCCACG
CTTCCCAAAGATACTGATAGACGGTCCATACGGAGCNCCAGCACAAGACTACCAAAANTATGAGGTAGTG
CTCCTGGTGGGGCTAGGGATCGGCGCCACGCCCATGGTGAGCATCGTGAAGGACATCATCAACAACATAAAAGTCAAAGAAAACGAGCAAGACCACNTGGGCTCGTTGGAGAGTGGAGGA
CGACCCGTCTCGCCACTAACCCCGGACGACAGCAACAGCCACTATCCCAAGGCGGGCCACAGGAGCAGCCATGGCAGAGGAGCGTTCAAGACCAGGAAGGCCTACTTCTACTGGGTGACC
CGGGAGCAGGGCTCGTTCGAGTGGTTCAAGGGGATCATGGATGAGGTGGCCGGGATGGACGAGCGGCAGGTCATCGAGCTCCACAACTACTGCACGAGCGTGTTCGAGGAGGGCGACGCC
CGGTCGGCCCTCATCGCGATGCTCCAGACCCTCAACCANGCGAAGCACGGGGTCGACGTCGTGTCCGGGACCCGGGTCATGTCCCACTTCGCCAAGCCCAACTGGCGCCAGGTCTACAAG
AAGATCGCGCTGCACCACCCCGACAAGCGAGTTG
GAGTCTTCTATTGTGGGGCGCCGGCGTTGACAAAGGAGTTAAATCACTTGGCTCTGGATTTCTCTCGCAAGACATCCACCAAGTTC
GACTTCCATAAGGAGAACTTTTGA

Retrieve as FASTA