Entry information : EguRboh06
Entry ID 11612
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2012-12-17 (Qiang Li)
Sequence status complete
Reviewer Christophe Dunand
Last annotation changes 2016-02-16 (Christophe Dunand)
Peroxidase information: EguRboh06
Name EguRboh06
Class Respiratory burst oxidase homolog    [Orthogroup: Rboh001]
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh06
start..stop
S start..stop
EgrRboh06 1776 0 1..857 1..857
EglRboh06 1773 0 1..857 1..857
EcamRboh06 1764 0 1..857 1..857
VvRboh08 1254 0 3..857 11..843
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 3178..3547 370 N° 2 3651..3813 163 N° 3 3884..3932 49 N° 4 4026..4139 114
N° 5 4238..5044 807 N° 6 5320..5415 96 N° 7 5506..5621 116 N° 8 5722..5824 103
N° 9 5947..6038 92 N° 10 6118..6328 211 N° 11 6360..6494 135 N° 12 6627..6755 129
N° 13 6830..6908 79 N° 14 7016..7122 107  
join(3178..3547,3651..3813,3884..3932,4026..4139,4238..5044,5320..5415,5506..562 1,5722..5824,5947..6038,6118..6328,6360..6494,6627..6755,6830..6908,7016..7122)


exon

Literature and cross-references EguRboh06
Protein sequence: EguRboh06
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   857
PWM (Da):   %s   97922.31 Transmb domain:   %s   o290-308i423-445o471-493i659-676o
PI (pH):   %s   9.75
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MGDSSKWILESIEVDDMADVPLDSSNKSGVHSGGPTSKVNDEAMLARSSSSTRKRVGFQGTGPPALSRMGRTESGARRGLKSLRFLDRTITGKEVDAWKSMEKRFNQFAVDGRISKDKFGTCIGMGESKEFAGELFXXLARRRKIHSENGITQEEMRAFWDDMTNQDIDSRLQIFFDMCDKNGDGKLSEEEVKVIILSASANKLSNLKQQAASYAVLIMEELDPDHLGYIEMWQLETLLREMVSSEEANKLAKKTHTLARTMIPRQYRTPISKFLSKTFEFLQENWKRVWVMSLWLTLNLILFVWKFRQYKERDIFQVMGYCVCFAKGAAETLKFNMALILIPVCRRTLTKLRSTALSRIFPFDDNINFHKSIALAIVIGTSIHIIMHLSCDFPRLISCPKPKFLRYAGPNFDYKQPSYLDLVESVPGVTGIIITILMAFSFTLAMHSFRRNVIKLPWPFHHLAGFNAFWYAHHLLFLVYALLIVHGYFLFLSRHWYSKSTWMYLSVPLLLYVSERIFTAIDERNHRVNVIKAIIYTGNVLALYISKPPGFKYKSGMYMFVKCPDISNFEWHPFSITSAPGDDYLSVHIRTLGDWTTELKNRFAVCEPPNEPAGRGSLVRLQTKAISDYDHTQVRFPRILIKGPYGAPAQNYKKYDILFLIGLGIGATPFISILKDLLNQIKPNEQNNVSQKFITSNKFSRCRRDPGQSIPGANKKAPERAYFYWVTREQGSFEWFKGVMDDIAEYDHNHIIEMHNYLTSVYEEGDARSALIAMVQKLQHAKNGVDVVSESRIRTHFARPNWRKVFSQLASAHPSSRIGVFYCGSPTLTKPLKKLCQEFSLNSSTRFQFHKEN

Retrieve as FASTA  
Remarks Complete sequence from genomic.
scaffold_10_34793 (3178..7122)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGACTCCTCTAAATGGATTCTGGAAAGCATCGAGGTCGACGACATGGCTGATGTGCCCTTGGACAGCTCCAACAAAAGCGGCGTTCATAGCGGCGGCCCGACTTCCAAGGTGAAT
GATGAGGCAATGCTCGCCCGGAGCTCGAGCAGCACGAGGAAGCGAGTCGGGTTTCAGGGCACTGGGCCACCGGCGTTGTCTAGGATGGGAAGGACCGAATCCGGTGCCAGGAGAGGGCTC
AAGAGCTTGAGGTTCTTGGACAGGACCATCACAGGGAAGGAGGTGGACGCTTGGAAGTCCATGGAGAAACGTTTCAACCAATTCGCAGTCGATGGGAGGATCTCGAAGGACAAGTTCGGG
ACCTGCATTG
GTAATTCGACGCTGACTTGGAAACCCCAAGACGGGGTCCTGCTTGAAATCTAACTTTTCCTGGGGAAAAAAGAGCTCAGGGGTTGTGAAATGCTGTGTTGCAGGAATGGG
AGAATCCAAGGAATTTGCGGGGGAGCTGTTTGANNCATTGGCGAGGCGTAGGAAGATACACTCGGAGAACGGGATTACTCAGGAGGAAATGAGGGCGTTTTGGGACGATATGACTAACCA
GGACATTGACTCACGCCTTCAAATCTTCTTTGACAT
GTAAAGAATTGTGCTTTCTGTGTCTCTNGGTTGTGTTGTTCACAGGAAACTAACTTCGCTAGTGTTTCAGGTGTGACAAAAATG
GCGATGGTAAGCTCTCCGAGGAGGAGGTGAAGGAG
GTGAGAGATAGCAACTTCCCAAAATCTCCTCTTCTTGTGTTTTTGGACGCTAATGGATAAAATTCTTTTACCTTTTAATTCTGGC
AAGTGAAGGTAATCATATTGAGCGCTTCAGCAAACAAGCTGTCCAATCTCAAGCAGCAAGCCGCATCCTATGCTGTGTTGATCATGGAAGAGCTCGATCCTGACCATCTTGGGTATATCG
AA
GTGAGTAGAAGTCTAGAGCCATTCCTTGAGAAGTGCATGTTTGTGTGTTCATCTATCGAGTCCTCTCTCTCTCTTCCTAATTTTGCAAGCTTAAGCAGATGTGGCAACTCGAGACTCT
ACTGAGGGAGATGGTGAGCTCCGAAGAAGCCAACAAGCTGGCCAAAAAAACCCACACTCTTGCAAGGACCATGATTCCGAGACAATATAGGACTCCGATCAGCAAATTTTTATCGAAAAC
CTTCGAATTTCTCCAGGAGAATTGGAAGAGAGTGTGGGTCATGTCACTTTGGTTGACTCTAAATTTGATCCTTTTTGTCTGGAAGTTCCGTCAATACAAGGAGAGAGACATATTTCAAGT
CATGGGTTACTGTGTTTGTTTTGCGAAGGGCGCTGCTGAGACGCTCAAATTCAACATGGCCCTTATTCTCATCCCTGTGTGTAGGAGGACGCTTACTAAACTTAGATCAACTGCCCTAAG
TAGGATATTTCCTTTCGACGACAATATTAATTTCCACAAGTCGATAGCACTGGCAATAGTAATCGGGACTTCAATACATATTATTATGCACCTTTCGTGTGATTTCCCAAGACTAATTTC
ATGTCCTAAGCCAAAGTTTTTGAGGTACGCGGGGCCTAACTTCGATTACAAGCAGCCAAGTTACTTGGATCTAGTTGAGAGCGTTCCTGGCGTTACCGGGATTATAATTACCATCTTGAT
GGCTTTCTCTTTCACACTGGCCATGCATTCATTTAGAAGGAATGTCATCAAGTTACCTTGGCCATTCCACCATCTAGCCGGGTTCAATGCCTTCTGGTACGCTCACCATTTGCTGTTCCT
GGTCTATGCTCTCTTGATAGTGCACGGCTACTTCCTGTTTCTGAGTAGGCACTGGTACTCAAAAAGT
GTAAGTATGACTTATGCACTTGAACTAAATCATTTTATTTGTTCATAGATTTG
TCAGATGNTTTTACTGCGACGACAGAACTGTTTCTGCTTAACAATGTGTTTGTATTCAATGCTATGCTTAACATGTCATCTTTGGTTCATTGCATATTTGAATTTCATTGAANGTGTTCT
TGAGCTTAAAATACCTTATAACTTTGTCAAGTGATATTGCTGTCTTAGTTTCATGCTGATGAAAGAAAGCTATTATGAACTGTTAAATTTCTTCCTGTGCAGACATGGATGTATCTCTCT
GTTCCTTTATTACTTTATGTCAGCGAGAGAATTTTCACAGCTATTGACGAGCGCAACCATCGTGTCAATGTTATCAAG
GTCAGCAATCATAGAGCTCTCCTGCCTTCGATTCTCAAGTCC
CAGGAACATGTATAAGTGCTTATGAACTGAATACATGAGTTATTGCAGGCAATCATATACACAGGAAATGTTTTGGCGTTGTACATAAGCAAACCCCCAGGATTCAAGTATAAAAGCGGA
ATGTATATGTTTGTCAAGTGTCCAGATATTTCCAACTTCGAGTG
GTAATGCATTGCTTTACTCAACAACAGGCTAAACCAAGTCTGTTAGTNGCTAGCTGCACATTTTTATGAATTGAGC
TGATTGATTTGTCACTTGTCATAGGCATCCTTTTTCTATCACTTCCGCACCAGGAGATGACTACTTGAGTGTCCACATACGAACCTTGGGAGACTGGACCACGGAGCTTAAGAACAGATT
TGCACAG
GTTAACAGATTATGGTGCTATGGCTAGAAGTTTATCTACTATAACGCACTACTGCTTGCTTCTTGATCTTAAATGTCTCACTTTCTGTTTCCACTTTTAAGTGCTAAGTCGAA
GAATTGCAGGTTTGTGAGCCACCGAACGAGCCAGCGGGAAGGGGAAGTCTAGTGAGGCTTCAAACCAAGGCAATCTCAGATTATGATCACACACAAGTCAGGTAAAGCAAAGTTTTGGTG
ATCTCGTTTTGTGGCTTCAATGATGATGTTAAATCTCATAATTTCTCCTCAATTTTATAGATTCCCGAGAATCCTCATTAAGGGACCGTATGGAGCCCCAGCTCAGAACTACAAAAAGTA
CGACATCCTTTTCCTTATCGGTCTAGGGATCGGGGCAACACCATTTATCAGCATTTTGAAGGACCTCCTCAACCAGATCAAGCCGAACGAACAAAACAATGTGAGCCAAAAGTTTATAAC
TTCAAACAAGTTTAGCAGATGTAGGAGACAA
GTAGNAAACAGGATGGTTTGACCACTTGCAGGATCCTGGACAAAGCATACCAGGTGCAAATAAGAAGGCACCGGAAAGAGCATACTTCT
ATTGGGTAACAAGGGAACAGGGTTCGTTTGAATGGTTCAAAGGTGTGATGGATGATATCGCAGAATACGACCATAAT
GTAAGTTCCAAAACAATGGAAAACATGCTTCATGACCACCTCG
CCTTCTTACGTTTACACTCATTCTTGTAGTAGCACATCCTCTTCTGTTTATATCATTCTCACTGTTTATTGGTCTAATGAGCTGAGCAGCATATAATAGAGATGCACAACTACTTGACTA
GTGTATATGAAGAAGGAGATGCACGGTCAGCACTCATCGCAATGGTGCAGAAGCTGCAGCATGCAAAGAATGGAGTGGATGTTGTCTCAGAAAGCCGG
GTATATGCCTCTAGTTATTATT
CCTCTGATCATTTAATTCATGTCTGGCTCATTTCTGACATACGTGCGCACAGATAAGAACGCATTTTGCGAGGCCTAACTGGAGAAAGGTGTTCTCCCAACTGGCAAGTGCTCATCCTTC
TTCTCGAATAG
GTACTGGTTTTGATTTGCGGCCATGGAGAAATGTCAAAATGCACTTAACTGATGAGATTGTTCTCATTCTGGCTTTTGCCTCTAATGTGGATGTTGGGCCCTTGCAGGT
GTTTTCTACTGTGGAAGTCCAACGCTTACTAAGCCGTTAAAGAAGCTTTGTCAAGAATTCAGCCTAAACTCATCGACCCGTTTCCAATTTCACAAGGAAAACTTC

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGGGGGACTCCTCTAAATGGATTCTGGAAAGCATCGAGGTCGACGACATGGCTGATGTGCCCTTGGACAGCTCCAACAAAAGCGGCGTTCATAGCGGCGGCCCGACTTCCAAGGTGAAT
GATGAGGCAATGCTCGCCCGGAGCTCGAGCAGCACGAGGAAGCGAGTCGGGTTTCAGGGCACTGGGCCACCGGCGTTGTCTAGGATGGGAAGGACCGAATCCGGTGCCAGGAGAGGGCTC
AAGAGCTTGAGGTTCTTGGACAGGACCATCACAGGGAAGGAGGTGGACGCTTGGAAGTCCATGGAGAAACGTTTCAACCAATTCGCAGTCGATGGGAGGATCTCGAAGGACAAGTTCGGG
ACCTGCATTG
GAATGGGAGAATCCAAGGAATTTGCGGGGGAGCTGTTTGANNCATTGGCGAGGCGTAGGAAGATACACTCGGAGAACGGGATTACTCAGGAGGAAATGAGGGCGTTTTGG
GACGATATGACTAACCAGGACATTGACTCACGCCTTCAAATCTTCTTTGACAT
GTGTGACAAAAATGGCGATGGTAAGCTCTCCGAGGAGGAGGTGAAGGAGGTAATCATATTGAGCGCT
TCAGCAAACAAGCTGTCCAATCTCAAGCAGCAAGCCGCATCCTATGCTGTGTTGATCATGGAAGAGCTCGATCCTGACCATCTTGGGTATATCGAA
ATGTGGCAACTCGAGACTCTACTG
AGGGAGATGGTGAGCTCCGAAGAAGCCAACAAGCTGGCCAAAAAAACCCACACTCTTGCAAGGACCATGATTCCGAGACAATATAGGACTCCGATCAGCAAATTTTTATCGAAAACCTTC
GAATTTCTCCAGGAGAATTGGAAGAGAGTGTGGGTCATGTCACTTTGGTTGACTCTAAATTTGATCCTTTTTGTCTGGAAGTTCCGTCAATACAAGGAGAGAGACATATTTCAAGTCATG
GGTTACTGTGTTTGTTTTGCGAAGGGCGCTGCTGAGACGCTCAAATTCAACATGGCCCTTATTCTCATCCCTGTGTGTAGGAGGACGCTTACTAAACTTAGATCAACTGCCCTAAGTAGG
ATATTTCCTTTCGACGACAATATTAATTTCCACAAGTCGATAGCACTGGCAATAGTAATCGGGACTTCAATACATATTATTATGCACCTTTCGTGTGATTTCCCAAGACTAATTTCATGT
CCTAAGCCAAAGTTTTTGAGGTACGCGGGGCCTAACTTCGATTACAAGCAGCCAAGTTACTTGGATCTAGTTGAGAGCGTTCCTGGCGTTACCGGGATTATAATTACCATCTTGATGGCT
TTCTCTTTCACACTGGCCATGCATTCATTTAGAAGGAATGTCATCAAGTTACCTTGGCCATTCCACCATCTAGCCGGGTTCAATGCCTTCTGGTACGCTCACCATTTGCTGTTCCTGGTC
TATGCTCTCTTGATAGTGCACGGCTACTTCCTGTTTCTGAGTAGGCACTGGTACTCAAAAAGT
ACATGGATGTATCTCTCTGTTCCTTTATTACTTTATGTCAGCGAGAGAATTTTCACA
GCTATTGACGAGCGCAACCATCGTGTCAATGTTATCAAG
GCAATCATATACACAGGAAATGTTTTGGCGTTGTACATAAGCAAACCCCCAGGATTCAAGTATAAAAGCGGAATGTATATG
TTTGTCAAGTGTCCAGATATTTCCAACTTCGAGTG
GCATCCTTTTTCTATCACTTCCGCACCAGGAGATGACTACTTGAGTGTCCACATACGAACCTTGGGAGACTGGACCACGGAGCTT
AAGAACAGATTTGCACAG
GTTTGTGAGCCACCGAACGAGCCAGCGGGAAGGGGAAGTCTAGTGAGGCTTCAAACCAAGGCAATCTCAGATTATGATCACACACAAGTCAGATTCCCGAGA
ATCCTCATTAAGGGACCGTATGGAGCCCCAGCTCAGAACTACAAAAAGTACGACATCCTTTTCCTTATCGGTCTAGGGATCGGGGCAACACCATTTATCAGCATTTTGAAGGACCTCCTC
AACCAGATCAAGCCGAACGAACAAAACAATGTGAGCCAAAAGTTTATAACTTCAAACAAGTTTAGCAGATGTAGGAGACAA
GATCCTGGACAAAGCATACCAGGTGCAAATAAGAAGGCA
CCGGAAAGAGCATACTTCTATTGGGTAACAAGGGAACAGGGTTCGTTTGAATGGTTCAAAGGTGTGATGGATGATATCGCAGAATACGACCATAAT
CATATAATAGAGATGCACAACTAC
TTGACTAGTGTATATGAAGAAGGAGATGCACGGTCAGCACTCATCGCAATGGTGCAGAAGCTGCAGCATGCAAAGAATGGAGTGGATGTTGTCTCAGAAAGCCGG
ATAAGAACGCATTTT
GCGAGGCCTAACTGGAGAAAGGTGTTCTCCCAACTGGCAAGTGCTCATCCTTCTTCTCGAATAG
GTGTTTTCTACTGTGGAAGTCCAACGCTTACTAAGCCGTTAAAGAAGCTTTGTCAA
GAATTCAGCCTAAACTCATCGACCCGTTTCCAATTTCACAAGGAAAACTTC

Retrieve as FASTA