Entry information : EguRboh07
Entry ID 11613
Creation 2012-12-05 (Qiang Li)
Last sequence changes 2013-01-22 (Qiang Li)
Sequence status partial
Reviewer Christophe Dunand
Last annotation changes 2016-03-12 (Christophe Dunand)
Peroxidase information: EguRboh07
Name EguRboh07
Class Respiratory burst oxidase homolog     [Orthogroup: Rboh001]*
Taxonomy Eukaryota Viridiplantae Streptophyta Myrtaceae Eucalyptus
Organism Eucalyptus gunnii    [TaxId: 3933 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value EguRboh07
start..stop
S start..stop
EcamRboh07 1346 0 13..694 2..683
EgrRboh07 1304 0 16..694 29..796
MtRboh06 904 0 25..694 50..815
CsRboh07 850 0 18..694 26..784
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 11243..11543 301 N° 2 10062..10218 157 N° 3 9917..9965 49 N° 4 9711..9824 114
N° 5 9212..9490 279 N° 6 8626..9012 387 N° 7 8251..8346 96 N° 8 7937..8052 116
N° 9 7690..7792 103 N° 10 7451..7615 165 N° 11 6953..7081 129 N° 12 6444..6522 79
N° 13 6061..6167 107  
complement(join(6061..6167,6444..6522,6953..7081,7451..7615,7690..7792,7937..805 2,8251..8346,8626..9012,9212..9490,9711..9824,9917..9965,10062..10218,11243..115 43))


exon

Literature and cross-references EguRboh07
Protein sequence: EguRboh07
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   694
PWM (Da):   %s   76773.04 Transmb domain:   %s   o217-236i301-320o351-373i404-426o
PI (pH):   %s   8.88
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
SSSSSSSSSSSSSSSYGASVVPVPYSPVQTDRDHRADDHDXGINGGTAAATSLAIQRLRFLDASAKHWRQVEERFDRIARDRYRNGVEPAARWSDFAFCVGIQRSTEYAQELLRALRGRDGLKSDVTKSELHYFWRRLTDPCPDSKIQIFFDLCDRNMDGIXSRRDVKVILMSAAANKVSLTGEEVDEYAALIMDAVGSGDRGYIEVLFRSYWRRAWIVALWLXICVALFTWKFIQYXHRXAFXVMGYCLCTAXGAAETLKFNMAVILLPVCRNTVTWLRASRRVSSIVPFNDNINFHKLIAAGIVIGVILHGGTHLACDFPRISSSDHSIFRQTIAAGFGYHQPSYLQILATTEVATGIAMVVLMAIAFSLATRWPRRQAPPLPRSVRQVTGYNTFWYSHHLFVFVYALLIVHSMFLFLTSNLIEKTTWMYIAFPVLLYTGERIFRAVRSXFYEVEILKANVYPGKVLSLXISKPEGFEYRSGMYIYIQCSRISPFEWHPFSLTSGPDEGHLSVHIRTLGDWSYQLYSLFQATVARTASYPKMYXDGPXGAASQDYVKYDVVVLVGLGIGATPFISILKDVVGCDHSIMEMHNFLTSMYKEEDARSVLLSXIQALSHAKSGVDFISQTPVHTHFARPNWSSIFSKLSRRHGSSQIGVFYCGPSALARELEDLCTKFSTKTITRFVFHKEH

Retrieve as FASTA  
Remarks Partial sequence from genomic (5' end and PS are missing). scaffold_2_3041 (11543..6061)
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTCCTCGTCTTCCTCCTCCTCATCCTCTTCCTCCTCGTCTTCCTACGGCGCCAGCGTGGTTCCGGTCCCGTACTCTCCCGTCCAGACGGACCGGGATCACCGTGCCGATGATCACGAC
NGCGGAATCAACGGCGGCACGGCGGCGGCAACTAGCCTGGCCATCCAGCGGCTGAGGTTCCTGGACGCGAGCGCCAAGCACTGGAGGCAGGTGGAGGAGCGGTTCGACCGGATCGCCCGG
GACCGCTACCGGAATGGCGTCGAGCCGGCGGCCAGGTGGTCGGATTTCGCCTTCTGCGTCG
GTGAGTGCTCCGGAACATAGGCAAAACGATTAACGATTAACGGTTAACGATTTCTCGGC
GATTCAATTAGAAAATTTAAATCAAAATACATNTTTTTTATATTTCATNTTCGCATTTTTTGAGAGAAATTTGGATGCCATTGAGCGTTCAACATGCGAGGTTGTACGCGTCCATGCAAG
GCGCGCTCTCGCTAACGTGCGCTCCCGCCGCTANCCGGCACGTATANGGTGCTCAATGGCTGCCACGTAAGCAGGCGCACGTTAGCACGGAAAATGCTTTTTAGATTTCAGTTTTCATCA
AAGGGAAAAAAAATAGGAAAAATACAAGAAATAAATTACAGTTTCGAACTATCGATACTTTTTATTTTGAAGCTTCTAAAATAATTTCGACAATTTTTTCGTAACTTTTTCGTATGTTTT
TCTTTCCAAATTATGCACGTGATTCACGTTTCTTTTTCCGTACATGATTCGTTTCGATAATTGTAACGGCCGGTGAGTGTGTAAATTGCAAATTATCCTAAAATTTCAAAAATATATGCA
TATATGAAATANTNTCATTTATGCAAAAATGGAGTCTTGAAGACATGTGATATGATGAAGCGCAAATAAAAATAACAAGTCATTTCGATAANTTTTTTAATAATTTTTATATGTATTTAT
TTTCCAAATTATTGTGATGCTTTGGTATTTAGAATTGTTCGTCAAAAAAAAAGTATGCAGGCGATTCACTTTTTGTTTTTTTTTGTTCTGTACGTGATTCATTTCAATAACCATGACAGC
TACTGAGTAATGTAGATAATAAATTGTCCTAGTCTATGCAAAAATGGAGTCTTGAAAACAAGTGATGTGACGGCGCATAAAGAAAGAATGTCAATTACGATATTTTTCCAGAAAAAAAAA
AACCCTAGAAATGTACTAAAATTGTATTATATGCACATATATTTTCTAATTCATATGTTGAGATTTTTTATTGAAGTGCATGGATGAGAAAAATGTGGAAAAACTTTTGGTTTGACAATC
GANAGGAATTCAACGGTCAACGGAGTACGCCCAGGAGCTGCTGCGAGCGCTGCGAGGGAGAGACGGCCTCAAATCCGACGTCACAAAGAGCGAACTCCACTACTTCTGGCGCCGCCTCAC
CGACCCGTGCCCCGACTCCAAAATCCAGATCTTCTTCGACTT
GTAATCAATTCAAATTCATCGCCATTTCCATGAATTATTCTGTACATTTCGATCGCGGAAAATACCCGTTTNTTCATT
TTTAATTATATCGNGCAGGTGCGACCGAAATATGGATGGGATANTTAGCCGGCGCGACGTCAAGCAGGTGCGCTGCTCCGTTCGTTTCGCGGAAAATGAAAGATAGTTTTCTGCATGCTG
CAGCCTTCCTCAAGATTTTCGAAACTTTGATTTGGGCAGGTGATCTTGATGAGTGCTGCCGCGAACAAGGTGAGCTTGACCGGCGAGGAGGTGGACGAGTACGCCGCNCTGATCATGGAC
GCCGTCGGCTCGGGAGATCGAGGTTACATAGAG
GTGATGACGCCTTCAACGAGAGGAATGAAATGGTGGTAAAAGCTCAACGTTGCCTGACTGATGTCATGACATGTTCACTGTGCAGAT
ATCTCAAGTGGAGACGCTGCTGAAGCTCGGGTTGTCGAAGGACTCTTCCGCCGCTGCCCCGTCGCCGAGGCTGTGCTACCGCGGGGGCTGGGACTCGGATGGGGTGGTCGGGCGGCCCAT
GTCGACGCTGGAGGTCTTGTTCCGGAGCTACTGGCGACGGGCGTGGATCGTGGCCCTCTGGCTGGNGATTTGCGTNGCGCTGTTCACGTGGAAGTTCATTCAGTATANGCATAGGNCGGC
GTTCNAGGTCATGGGCTACTGCCTTTGCACCGCCAANGGGGCTGCCGAGACCCTCAAGTTCAACATGGCCGTGATTCTNCTCCCCGTCTGCCGGAACACGGTCACGTGGCTCCGCGCCAG
CCGCCGGGTCAGCTCGATCGTCCCCTTCAACGATAACATCAACTTTCACAAG
GTAGANGAGNAGTGCATNGTGATTCATGNAATATTNTCAACATTCTANNATCNTATACTAGCAGCATG
ACTGATTCCTATCAAATAAGAACCAAGTTTCGGCTCGANATTTNGNAAACTGGTTGATTTCATAGTGTCAAGCAACGGTCATCTCCTNNCTGATGCAACTGTAAACACCCGAATTCATTT
NTCTATNACAGTTGATCGCAGCTGGGATCGTGATCGGGGTGATCCTCCATGGNGGCACCCACCTGGCGTGCGACTTCCCTCGGATCAGTAGCTCNGATCACTCCATCTTCCGCCAGACGA
TTGCTGCAGGGTTCGGCTACCATCAGCCATCGTATCTCCAGATCCTGGCCACGACGGAGGTGGCAACAGGGATCGCAATGGTGGTCCTTATGGCAATCGCNTTCTCCCTNGCGACAAGGT
GGCCAAGGCGCCAGGCCCCGCCGCTGCCCCGGTCNGTCCGGCAGGTCACGGGGTACAACACCTTCTGGTACTCACACCACCTCTTCGTCTTCGTGTACGCACTGTTGATCGTGCACTCCA
TGTTCCTCTTCCTGACCAGCAACCTAATAGAAAAGACG
GTAGGTNGCTCNGACTTTTAGATTCGTACAGAATAGTGCTGATCCGATGTCATTGTCTCGACAAACGTATGGATTTTTCANA
ACTTCACTGGAGTTCTTGCTTAGAAATTANAAGCAGTTCTCAGCATGCATCACAATTCCCACAAGAAATGCAAGAAATTTGGAGAGCTGCAATTTTCTACTAATATAANCTGCAATTCCG
AGATTCGATTCAATGAGAATGTACACCTTTTCTAACGTCGTCACTGATTCATGCATAATGCCGNTCTGGTTGCACAGACATGGATGTATATCGCCTTTCCAGTGCTGCTGTACACGGGAG
AGAGGATCTTCCGGGCTGTCAGATCGNCATTTTATGAGGTGGAGATACTGAAG
GTATGTCAAGTCATTNACCATGCTGCGAAAATGGTTTACCAGACTTGTATAGATCATATNGAAATCA
TGTTCGGTCGGGTCTGGAATGTCCTGTNGCCAGCCGACTNTCATGGAATATGTTTTCCCGTGAAACAAACGACCCTCATGTGGTATTGTTCTGATCATGTAAACAGATAACTGCTGTATT
TTCTCATGTAGGCAAATGTGTATCCAGGAAAGGTTTTGTCCCTGANAATTAGCAAGCCCGAAGGCTTTGAGTACAGAAGTGGAATGTATATATACATTCAATGCTCTCGAATATCACCCT
TCGAATG
GTATTCTGCATGCCTTCTTTCTTTTCAAACCGGTCGTCNCCTTGTCCCTTCCAAACTGTGACAGCTATGAGATTATCGCGACGCTCTCCTTGTACTTTTGCCTGTTTAAAACG
ACCGTGCTTTCGNTTCTATGTTGATGTCCAGGCACCCGTTTTCATTGACTTCTGGACCAGATGAAGGTCACTTGAGTGTGCACATTAGGACACTTGGAGACTGGAGTTATCAATTATACA
GTCTCTTCCAAGAG
GTAAGGAACAAAAAGGACNCGAATCGATACTCCTCAGAAACCNGGAATCCAAATCTCTGTTGTTTTCTATGCAGGCAACTGTGGCAAGAACAGCTAGCTATCCCAA
AATGTACATNGACGGGCCTTANGGNGCAGCCTCTCAGGACTATGTCAAGTACGACGTCGTGGTTCTGGTTGGCCTCGGAATAGGAGCAACGCCATTTATCAGCATTCTTAAGGATGTCGT
CGGTTGCGATCAT
GTAAGTTTCTAGGTTACACCTCCCTTGCATTGTTGAATAAGATATTCAATATGCTTTATTTAACCCTGTGCTGACACAAGGTAANTGCTCGATTTACCAGGTGGATG
GCGGAGAAGTCAGCATTCCGAAGGGTCCAGCGAAAGCCTATCTGTACTGGGTTACGAGGGATCAGAGCTCCTTTGCCTGGTTCAGGGATTTCATCAAGCAGATATCAAAGACCAACCGGA
AAGAGGTNACTGATTGATTCTTACGGCAGCAAGCAAAACCTGAAAATGTCTTCAAGAAAATGAAGTTGACATGAGTCTTTATAGGCACTGATTTGATATTTGCTTGTACTTGAAAACCAA
ATTAGTTGTTGTTCCTTTTCAGTCGATTATGGAGATGCACAACTTCCTGACCTCGATGTACAAGGAGGAGGATGCGCGGTCAGTGTTACTAAGCNCCATTCAAGCTCTGTCTCATGCCAA
GAGCGGTGTCGACTTCATCTCTCAGACCCCG
GTTAGTCGTTCGATTATACTCCACATCTCCGCGTCTGATTTCTGCGTGGCAACAGCTTCCAGCTTGTCCATAAAACTTTAAGATCTTGT
TCTTGATTAAAAAGATGCGAAGTCGGGCAGTTAGAAGCCCGATCGATGATCATGGTCACGAACTTTTTAGCAATCTCAGTTGGCTGTTCGTCTTTAATTGTCATCATGCTAAAACCATAT
GTCCTTTCCGGAGTTGTGTTTGCATGTCTTAAAAGTACAGTCTTCCCATTAACAATGCACTCGGCATGCAGTTATGACGTAAATCTTCTTGCCATCCCTNCAAATCGATTAGCACGAATG
ATTATGACNAAAGCATTCNAATTCAGTTCAACCACTCGTGAATTCATGAGAATACCTCTCGCTACAAGATCGGTTGATCTAACTTCTAATGTCATTTTCAGGTGCATACTCATTTTGCCA
GACCAAATTGGTCCAGCATTTTCTCCAAGTTGTCCCGAAGGCACGGCAGTTCCCAGATTG
GTGAGACTTCGGCAAACCCCGTAACTACAGTACATCTTTATCATTTGCTTTCGGCATGCT
TCTGTGATTCCTCTAGTCGATGGCATTCTACAGCGTACAATTTACGGGATCCTAATCGAACTCTAGCGCCATGCCTTGACAAACCATTTGCAAATAATTCATGATGCATCCGTGTTAAAA
TCGAATTAGCTAGCGATCTCAGAAGGCACTTGCGGGACAGATTGTTTTTTNCTCCTCGATAGGGTTATATCTGAATCTCTGGCTTGTGATTTGCAGGGGTGTTCTATTGTGGTCCTTCAG
CATTAGCAAGAGAATTGGAGGATTTGTGCACCAAATTCTCCACCAAAACCATCACGAGATTTGTGTTCCATAAGGAGCATTAT

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
TCCTCCTCGTCTTCCTCCTCCTCATCCTCTTCCTCCTCGTCTTCCTACGGCGCCAGCGTGGTTCCGGTCCCGTACTCTCCCGTCCAGACGGACCGGGATCACCGTGCCGATGATCACGAC
NGCGGAATCAACGGCGGCACGGCGGCGGCAACTAGCCTGGCCATCCAGCGGCTGAGGTTCCTGGACGCGAGCGCCAAGCACTGGAGGCAGGTGGAGGAGCGGTTCGACCGGATCGCCCGG
GACCGCTACCGGAATGGCGTCGAGCCGGCGGCCAGGTGGTCGGATTTCGCCTTCTGCGTCG
GAATTCAACGGTCAACGGAGTACGCCCAGGAGCTGCTGCGAGCGCTGCGAGGGAGAGAC
GGCCTCAAATCCGACGTCACAAAGAGCGAACTCCACTACTTCTGGCGCCGCCTCACCGACCCGTGCCCCGACTCCAAAATCCAGATCTTCTTCGACTT
GTGCGACCGAAATATGGATGGG
ATANTTAGCCGGCGCGACGTCAAGCAG
GTGATCTTGATGAGTGCTGCCGCGAACAAGGTGAGCTTGACCGGCGAGGAGGTGGACGAGTACGCCGCNCTGATCATGGACGCCGTCGGCTCG
GGAGATCGAGGTTACATAGAG
GTCTTGTTCCGGAGCTACTGGCGACGGGCGTGGATCGTGGCCCTCTGGCTGGNGATTTGCGTNGCGCTGTTCACGTGGAAGTTCATTCAGTATANGCAT
AGGNCGGCGTTCNAGGTCATGGGCTACTGCCTTTGCACCGCCAANGGGGCTGCCGAGACCCTCAAGTTCAACATGGCCGTGATTCTNCTCCCCGTCTGCCGGAACACGGTCACGTGGCTC
CGCGCCAGCCGCCGGGTCAGCTCGATCGTCCCCTTCAACGATAACATCAACTTTCACAAG
TTGATCGCAGCTGGGATCGTGATCGGGGTGATCCTCCATGGNGGCACCCACCTGGCGTGC
GACTTCCCTCGGATCAGTAGCTCNGATCACTCCATCTTCCGCCAGACGATTGCTGCAGGGTTCGGCTACCATCAGCCATCGTATCTCCAGATCCTGGCCACGACGGAGGTGGCAACAGGG
ATCGCAATGGTGGTCCTTATGGCAATCGCNTTCTCCCTNGCGACAAGGTGGCCAAGGCGCCAGGCCCCGCCGCTGCCCCGGTCNGTCCGGCAGGTCACGGGGTACAACACCTTCTGGTAC
TCACACCACCTCTTCGTCTTCGTGTACGCACTGTTGATCGTGCACTCCATGTTCCTCTTCCTGACCAGCAACCTAATAGAAAAGACG
ACATGGATGTATATCGCCTTTCCAGTGCTGCTG
TACACGGGAGAGAGGATCTTCCGGGCTGTCAGATCGNCATTTTATGAGGTGGAGATACTGAAG
GCAAATGTGTATCCAGGAAAGGTTTTGTCCCTGANAATTAGCAAGCCCGAAGGCTTT
GAGTACAGAAGTGGAATGTATATATACATTCAATGCTCTCGAATATCACCCTTCGAATG
GCACCCGTTTTCATTGACTTCTGGACCAGATGAAGGTCACTTGAGTGTGCACATTAGGACA
CTTGGAGACTGGAGTTATCAATTATACAGTCTCTTCCAAGAG
GCAACTGTGGCAAGAACAGCTAGCTATCCCAAAATGTACATNGACGGGCCTTANGGNGCAGCCTCTCAGGACTATGTC
AAGTACGACGTCGTGGTTCTGGTTGGCCTCGGAATAGGAGCAACGCCATTTATCAGCATTCTTAAGGATGTCGTCGGTTGCGATCAT
TCGATTATGGAGATGCACAACTTCCTGACCTCG
ATGTACAAGGAGGAGGATGCGCGGTCAGTGTTACTAAGCNCCATTCAAGCTCTGTCTCATGCCAAGAGCGGTGTCGACTTCATCTCTCAGACCCCG
GTGCATACTCATTTTGCCAGACCA
AATTGGTCCAGCATTTTCTCCAAGTTGTCCCGAAGGCACGGCAGTTCCCAGATTG
GGGTGTTCTATTGTGGTCCTTCAGCATTAGCAAGAGAATTGGAGGATTTGTGCACCAAATTCTCC
ACCAAAACCATCACGAGATTTGTGTTCCATAAGGAGCATTAT

Retrieve as FASTA