Entry information : CposAPx-CcP1
Entry ID 11617
Creation 2012-12-21 (Marcel Zamocky)
Last sequence changes 2016-02-17 (Christophe Dunand)
Sequence status complete
Reviewer Achraf Jemmat
Last annotation changes 2016-02-17 (Achraf Jemmat)
Peroxidase information: CposAPx-CcP1
Name CposAPx-CcP1
Class Hybrid Ascorbate-Cytochrome C peroxidase    [Orthogroup: APx-CcP001]
Taxonomy Eukaryota Fungi Ascomycota Eurotiomycetes Coccidioides
Organism Coccidioides posadasii    [TaxId: 199306 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CposAPx-CcP1
start..stop
S start..stop
CimAPx-CcP01 1539 0 1..756 1..756
UrAPx-CcP01 1088 0 1..744 1..744
MicaAPx-CcP01 1040 0 8..739 6..737
MicaAPx-CcP01 88 4e-18 542..637 643..738
AgyAPx-CcP01 1025 0 10..739 8..737
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 86022..87158 1137 N° 2 87223..87423 201 N° 3 87481..88416 936  
join(86022..87158,87223..87423,87481..88416)


exon

Literature and cross-references CposAPx-CcP1
Protein ref. GenBank:   EFW16356.1 UniProtKB:   E9DJ84
DNA ref. GenBank:   GL636514.1 (86022..88416)
Protein sequence: CposAPx-CcP1
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   757 (736)
PWM (Da):   %s   81320.57 (79081.3)  
PI (pH):   %s   6.42 (6.26) Peptide Signal:   %s   cut: 22 range:22-757
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MMIAVILATLWAASALPKTWALPTWPSPADELEDLMFLHTGYRARGFAAGVTPCSFSKQGPSRIASAEWLRTAFHDMSTGNVFTGVGGLDASIMYEIGGNGGENPGPTFNNTLETFTPFFSPRASMADLIALGVHTAVRSCGGPIVKVRAGRIDATSRGPVGVPQPENSQRTFINQFARTGFNISEMIALTACGHTLGGVHAQDFPQIVKPGTVQNDFQLFDSTPEFDEKVASDFVKGVHTNPLAGALARTNTRDSDTKVFTADNNKTITALADAAAFRDTCAKMLQRMIEVVPSGVSLTDPISPYEVKPSHLQLALAGNGSTLYFSGEIRVRTTHQPASAIAKVQLLFKDRRGGTDCDSCTIGTEHKGNAAGFDDKFAFYGFSASLPVDTSISSFKVQITLASGKVEVYDNNGFEYRVQDTIMLQPKQSCFSKADSAGNLTITAAIRDTVASPNVTLALFMKIPRDCCVVPALKTKMIAMTKQRSIGPYTLFSSSYALEPFLKSSTIFDVSVTSGGKVILDSFKRTAELGSTCASFGSDGPTKPEFNYEGCFTDSVASRTLTGKASADDEMTIEKCGSQCKDYQFFGLEYGRECFCGNTKGSRSVKVEESECSMACGGDKSKVCGAQDRLNLYKNTAWIPTINLDIAGYKYLGCYEDSRGSRALSESFVYSDKMTVEMCASFCGGANYFGVEYYSECYCGATLSPKSSKQPETDCSFLCSGNSTQYCGGSDRINVYMKEPVPSGCKVDATSPTRRV*

Retrieve as FASTA  
Remarks Complete from genomic (2 introns). Peroxidase domain fused to 2 WSC domains (putative carbohydrate binding domain). Strain="RMSCC 757 / Silveira".
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATCGCCGTAATTCTGGCGACGCTATGGGCGGCTTCAGCTCTTCCCAAAACATGGGCCCTCCCAACGTGGCCTTCGCCTGCCGACGAACTCGAAGATCTTATGTTCCTCCACACC
GGCTACCGTGCTCGAGGATTTGCTGCCGGCGTAACGCCATGCTCTTTCTCCAAACAGGGCCCTTCTCGAATTGCGTCCGCCGAATGGCTTCGTACTGCGTTCCATGATATGTCCACCGGG
AATGTTTTCACTGGCGTCGGTGGCCTGGACGCCTCGATTATGTACGAGATAGGTGGAAATGGAGGAGAGAATCCCGGCCCAACATTCAACAATACCCTTGAAACCTTCACTCCCTTCTTC
TCACCAAGAGCCTCTATGGCCGACCTGATAGCCTTGGGAGTGCACACCGCCGTTCGATCCTGCGGGGGTCCGATAGTCAAGGTCAGAGCGGGAAGAATCGATGCGACTTCTCGAGGTCCT
GTTGGAGTGCCACAGCCTGAGAACTCCCAGAGGACGTTTATCAACCAGTTTGCGCGAACTGGATTCAACATCTCCGAAATGATCGCCTTGACGGCTTGCGGGCATACGTTAGGAGGAGTT
CATGCACAGGATTTCCCCCAAATTGTGAAACCGGGGACGGTGCAAAATGATTTCCAGTTGTTTGACTCGACCCCAGAATTCGACGAAAAGGTAGCGTCTGATTTTGTAAAAGGTGTTCAC
ACCAACCCACTGGCAGGAGCCCTTGCACGTACGAATACACGAGACTCTGACACGAAGGTGTTCACTGCGGACAACAACAAGACGATAACAGCGTTGGCTGATGCAGCCGCGTTCCGAGAT
ACATGCGCGAAAATGCTCCAAAGAATGATTGAGGTTGTTCCATCCGGAGTGAGCCTGACGGATCCCATTTCGCCATACGAAGTTAAACCTTCGCACCTTCAGCTCGCGCTGGCCGGAAAT
GGTAGTACACTGTATTTCTCCGGTGAGATTCGGGTCAGGACGACACATCAACCAGCCAGTGCAATTGCGAAAGTGCAACTCTTGTTCAAAGATCGCCGAGGTGGTACAGATTGCGATTCC
TGTACAATTGGCACCGAACACAAGGGAAATGCGGCGGGTTTTGACGACAAGTTTGCT
GTGCGTACTGTCTTGATCTAATATATACATATTTTATGGAATCACCTACTGATGAGGTGCGCA
GTTCTACGGATTCTCGGCCAGTTTACCGGTTGATACGTCCATCTCTAGTTTCAAGGTACAAATCACTTTGGCCTCAGGTAAGGTAGAGGTGTACGACAACAATGGATTCGAATATCGTGT
ACAGGACACGATCATGCTCCAGCCTAAACAGAGCTGCTTTAGCAAAGCCGATTCTGCTGGTAATCTGACAATCACCGCTGCT
GTAAGTCTCCCTACTTGTTGCCCTGAATCGTTCTATCA
ACGGCTGACCGACCCGAAGATCCGAGACACAGTAGCATCGCCAAATGTGACTCTTGCTCTATTTATGAAAATACCTCGAGACTGCTGTGTTGTCCCCGCGCTGAAGACAAAGATGATCGC
TATGACAAAGCAAAGGAGCATCGGCCCATATACCTTGTTCTCAAGCAGCTATGCGCTAGAACCCTTCTTGAAATCTAGTACAATATTTGACGTTTCCGTGACAAGCGGAGGCAAAGTCAT
ATTGGACAGTTTCAAGCGCACCGCCGAGTTAGGGTCGACGTGTGCGTCCTTCGGCTCAGATGGCCCTACCAAACCTGAGTTCAATTACGAGGGCTGCTTTACTGACAGCGTCGCCTCGAG
GACTCTTACCGGGAAAGCGTCCGCCGACGACGAAATGACGATTGAGAAATGCGGCAGCCAATGTAAGGACTACCAGTTCTTCGGTCTCGAATACGGGAGGGAGTGCTTTTGCGGCAATAC
AAAAGGCTCAAGGAGCGTTAAGGTCGAAGAATCTGAATGTTCCATGGCCTGCGGAGGCGATAAATCCAAGGTTTGCGGCGCGCAAGATCGCCTGAACCTCTATAAGAACACAGCTTGGAT
CCCCACGATAAACCTCGATATTGCGGGATACAAATACCTTGGATGCTATGAGGATTCGAGGGGCAGCCGTGCGCTATCAGAGAGCTTTGTGTATAGCGACAAGATGACGGTGGAAATGTG
TGCTTCCTTCTGCGGTGGGGCAAATTATTTCGGCGTCGAGTACTACAGCGAGTGTTATTGTGGTGCTACTCTATCGCCGAAAAGTTCCAAACAGCCAGAAACAGATTGCAGCTTCCTCTG
CTCTGGGAACAGTACTCAGTACTGCGGTGGGAGCGACAGGATCAATGTGTATATGAAGGAGCCTGTGCCCTCAGGCTGTAAGGTCGACGCAACATCCCCAACTAGACGTGTGTAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGATGATCGCCGTAATTCTGGCGACGCTATGGGCGGCTTCAGCTCTTCCCAAAACATGGGCCCTCCCAACGTGGCCTTCGCCTGCCGACGAACTCGAAGATCTTATGTTCCTCCACACC
GGCTACCGTGCTCGAGGATTTGCTGCCGGCGTAACGCCATGCTCTTTCTCCAAACAGGGCCCTTCTCGAATTGCGTCCGCCGAATGGCTTCGTACTGCGTTCCATGATATGTCCACCGGG
AATGTTTTCACTGGCGTCGGTGGCCTGGACGCCTCGATTATGTACGAGATAGGTGGAAATGGAGGAGAGAATCCCGGCCCAACATTCAACAATACCCTTGAAACCTTCACTCCCTTCTTC
TCACCAAGAGCCTCTATGGCCGACCTGATAGCCTTGGGAGTGCACACCGCCGTTCGATCCTGCGGGGGTCCGATAGTCAAGGTCAGAGCGGGAAGAATCGATGCGACTTCTCGAGGTCCT
GTTGGAGTGCCACAGCCTGAGAACTCCCAGAGGACGTTTATCAACCAGTTTGCGCGAACTGGATTCAACATCTCCGAAATGATCGCCTTGACGGCTTGCGGGCATACGTTAGGAGGAGTT
CATGCACAGGATTTCCCCCAAATTGTGAAACCGGGGACGGTGCAAAATGATTTCCAGTTGTTTGACTCGACCCCAGAATTCGACGAAAAGGTAGCGTCTGATTTTGTAAAAGGTGTTCAC
ACCAACCCACTGGCAGGAGCCCTTGCACGTACGAATACACGAGACTCTGACACGAAGGTGTTCACTGCGGACAACAACAAGACGATAACAGCGTTGGCTGATGCAGCCGCGTTCCGAGAT
ACATGCGCGAAAATGCTCCAAAGAATGATTGAGGTTGTTCCATCCGGAGTGAGCCTGACGGATCCCATTTCGCCATACGAAGTTAAACCTTCGCACCTTCAGCTCGCGCTGGCCGGAAAT
GGTAGTACACTGTATTTCTCCGGTGAGATTCGGGTCAGGACGACACATCAACCAGCCAGTGCAATTGCGAAAGTGCAACTCTTGTTCAAAGATCGCCGAGGTGGTACAGATTGCGATTCC
TGTACAATTGGCACCGAACACAAGGGAAATGCGGCGGGTTTTGACGACAAGTTTGCT
TTCTACGGATTCTCGGCCAGTTTACCGGTTGATACGTCCATCTCTAGTTTCAAGGTACAAATC
ACTTTGGCCTCAGGTAAGGTAGAGGTGTACGACAACAATGGATTCGAATATCGTGTACAGGACACGATCATGCTCCAGCCTAAACAGAGCTGCTTTAGCAAAGCCGATTCTGCTGGTAAT
CTGACAATCACCGCTGCT
ATCCGAGACACAGTAGCATCGCCAAATGTGACTCTTGCTCTATTTATGAAAATACCTCGAGACTGCTGTGTTGTCCCCGCGCTGAAGACAAAGATGATCGCT
ATGACAAAGCAAAGGAGCATCGGCCCATATACCTTGTTCTCAAGCAGCTATGCGCTAGAACCCTTCTTGAAATCTAGTACAATATTTGACGTTTCCGTGACAAGCGGAGGCAAAGTCATA
TTGGACAGTTTCAAGCGCACCGCCGAGTTAGGGTCGACGTGTGCGTCCTTCGGCTCAGATGGCCCTACCAAACCTGAGTTCAATTACGAGGGCTGCTTTACTGACAGCGTCGCCTCGAGG
ACTCTTACCGGGAAAGCGTCCGCCGACGACGAAATGACGATTGAGAAATGCGGCAGCCAATGTAAGGACTACCAGTTCTTCGGTCTCGAATACGGGAGGGAGTGCTTTTGCGGCAATACA
AAAGGCTCAAGGAGCGTTAAGGTCGAAGAATCTGAATGTTCCATGGCCTGCGGAGGCGATAAATCCAAGGTTTGCGGCGCGCAAGATCGCCTGAACCTCTATAAGAACACAGCTTGGATC
CCCACGATAAACCTCGATATTGCGGGATACAAATACCTTGGATGCTATGAGGATTCGAGGGGCAGCCGTGCGCTATCAGAGAGCTTTGTGTATAGCGACAAGATGACGGTGGAAATGTGT
GCTTCCTTCTGCGGTGGGGCAAATTATTTCGGCGTCGAGTACTACAGCGAGTGTTATTGTGGTGCTACTCTATCGCCGAAAAGTTCCAAACAGCCAGAAACAGATTGCAGCTTCCTCTGC
TCTGGGAACAGTACTCAGTACTGCGGTGGGAGCGACAGGATCAATGTGTATATGAAGGAGCCTGTGCCCTCAGGCTGTAAGGTCGACGCAACATCCCCAACTAGACGTGTGTAA

Retrieve as FASTA