Entry information : PsojGPx01
Entry ID 11629
Creation 2013-02-08 (Christophe Dunand)
Last sequence changes 2014-02-20 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2014-02-20 (Christophe Dunand)
Peroxidase information: PsojGPx01
Name PsojGPx01
Class Other glutathione peroxidase    [Orthogroup: N/D] N/D
Taxonomy Eukaryota Phytophthora
Organism Phytophthora sojae    [TaxId: 67593 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value PsojGPx01
start..stop
S start..stop
RnoGPx01 189 1e-60 75..279 4..200
MmGPx01 189 2e-60 75..272 4..193
DrGPx02-C 188 4e-60 85..275 5..188
DrGPx02-B 187 9e-60 81..274 2..188
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 806345..807073 729 N° 2 807150..807272 123  
join(806345..807073,807150..807272)


exon

Literature and cross-references PsojGPx01
DNA ref. GenBank:   JH159157.1 (806345..807272)
Protein sequence: PsojGPx01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   283
PWM (Da):   %s   31011.51  
PI (pH):   %s   8.48
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MKLPTGYGCETTNGDDASNGRSASAAQDGEDCVNGVLRPASQQNQYHNLPVAVAVPVTGIRSSAATTAAQSPDRARASSAAGRRKSAHNFSFRSLTGSKFIRLADFAGKPILVVNVASHCNSTTKAYVQLNDLAKRFPELVIIGCPCNQFGHQENLNGEEIYQSLRHIRPGKGFEPAFMLTEKVEVNGANAHALFNFLRITLPYPCDRTLLDEMSTPSGVFSHPMRLIWMPVTRADVSWNFEKFLISPDGTPYKRYSPRLDFTGMIEDIKFLCKVDLSNEKQL*

Retrieve as FASTA  
Remarks complete sequence from genomic (1 intron).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGCCGACGGGCTACGGCTGCGAGACCACGAACGGGGACGACGCCAGCAACGGCCGCAGCGCCAGTGCCGCCCAGGACGGAGAGGACTGCGTCAACGGCGTGCTGCGACCGGCC
TCGCAGCAGAACCAGTACCACAACCTGCCCGTGGCGGTGGCCGTGCCGGTGACGGGCATCCGCTCGTCGGCCGCCACCACCGCCGCCCAGAGCCCCGACCGCGCGCGCGCGTCGTCCGCG
GCGGGGCGCCGGAAGTCGGCGCACAACTTCTCGTTCCGCTCGCTCACGGGCTCCAAGTTCATCCGCCTGGCCGACTTCGCCGGCAAGCCCATCCTGGTCGTGAACGTGGCGTCGCACTGC
AACTCCACCACCAAGGCCTACGTGCAGCTCAACGACCTGGCCAAGCGCTTCCCGGAGCTCGTGATCATCGGTTGCCCGTGCAACCAGTTCGGCCACCAGGAGAACCTCAACGGCGAGGAG
ATCTACCAGAGTCTGCGGCACATCCGCCCCGGAAAGGGCTTCGAGCCGGCCTTCATGCTCACGGAGAAGGTGGAGGTCAACGGCGCCAACGCGCACGCGCTCTTCAACTTCCTAAGGATC
ACGCTGCCCTACCCGTGCGACCGCACGCTGCTGGACGAGATGTCCACGCCCAGCGGCGTCTTCTCGCACCCCATGCGCCTCATCTGGATGCCCGTCACGCGCGCAGACGTGAGCTGGAAC
TTCGAAAAG
GTGCGTCCGCAGCTGTAGTCTTCGAACTGTGTTGATCTTGTTGCTAACGTTGGTCTTGCTGCTTCTGCTGCTGCAGTTCCTCATCAGCCCCGATGGCACGCCCTACAAGCG
CTACAGCCCCAGGCTGGACTTCACGGGCATGATCGAGGACATCAAGTTCCTGTGCAAGGTGGACCTGTCGAACGAGAAGCAGCTATAA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGAAGCTGCCGACGGGCTACGGCTGCGAGACCACGAACGGGGACGACGCCAGCAACGGCCGCAGCGCCAGTGCCGCCCAGGACGGAGAGGACTGCGTCAACGGCGTGCTGCGACCGGCC
TCGCAGCAGAACCAGTACCACAACCTGCCCGTGGCGGTGGCCGTGCCGGTGACGGGCATCCGCTCGTCGGCCGCCACCACCGCCGCCCAGAGCCCCGACCGCGCGCGCGCGTCGTCCGCG
GCGGGGCGCCGGAAGTCGGCGCACAACTTCTCGTTCCGCTCGCTCACGGGCTCCAAGTTCATCCGCCTGGCCGACTTCGCCGGCAAGCCCATCCTGGTCGTGAACGTGGCGTCGCACTGC
AACTCCACCACCAAGGCCTACGTGCAGCTCAACGACCTGGCCAAGCGCTTCCCGGAGCTCGTGATCATCGGTTGCCCGTGCAACCAGTTCGGCCACCAGGAGAACCTCAACGGCGAGGAG
ATCTACCAGAGTCTGCGGCACATCCGCCCCGGAAAGGGCTTCGAGCCGGCCTTCATGCTCACGGAGAAGGTGGAGGTCAACGGCGCCAACGCGCACGCGCTCTTCAACTTCCTAAGGATC
ACGCTGCCCTACCCGTGCGACCGCACGCTGCTGGACGAGATGTCCACGCCCAGCGGCGTCTTCTCGCACCCCATGCGCCTCATCTGGATGCCCGTCACGCGCGCAGACGTGAGCTGGAAC
TTCGAAAAG
TTCCTCATCAGCCCCGATGGCACGCCCTACAAGCGCTACAGCCCCAGGCTGGACTTCACGGGCATGATCGAGGACATCAAGTTCCTGTGCAAGGTGGACCTGTCGAACGAG
AAGCAGCTATAA

Retrieve as FASTA