Entry information : AthiCcP01
Entry ID 11648
Creation 2013-02-27 (Christophe Dunand)
Last sequence changes 2013-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: AthiCcP01
Name AthiCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita thiersii    [TaxId: 235537 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AthiCcP01
start..stop
S start..stop
AmusCcP01 607 0 1..369 1..375
PoCcP_PC9 586 0 1..370 1..372
PoCcP_PC15 578 0 1..363 1..365
PrubCcP01 572 0 1..363 1..369
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 176113..176403 291 N° 2 176013..176061 49 N° 3 175878..175959 82 N° 4 175664..175817 154
N° 5 175492..175608 117 N° 6 175359..175441 83 N° 7 175220..175297 78 N° 8 175098..175169 72
N° 9 174958..175041 84 N° 10 174794..174899 106  
complement(join(174794..174899,174958..175041,175098..175169,175220..175297,1753 59..175441,175492..175608,175664..175817,175878..175959,176013..176061,176113..1 76403))


exon

Literature and cross-references AthiCcP01
DNA ref. JGI genome:   scaffold_4 (176403..174794)
Cluster/Prediction ref. JGI gene:   54139
Protein sequence: AthiCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   371
PWM (Da):   %s   41450.75  
PI (pH):   %s   8.74
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFTAFRAPLRRAVVSAATPRAAFRSSYRRFTTTPPEPRPKSNTPLFIGIGAFVTAGAFALYAYSDSGKDAATSVKSGIQAARVATRFVPTKDDYQKVYNRIAEVMDDAGDYDDGSYGPVLLRLAWHSSGTYDKETKTGGSNFATMRFEPESLHGANNGLGVARGLMEKVKAEFPWLSYGDLWTLAGVVAIEMAGPKIPWRPGRIDGFATDATPDGRLPDASQASDHLRAIFYRMGFNDQEIVALSGAHALGRCHSDRSGFEGPWTFSPITLTNDYYKLLFDEKWVWKKWNGPKQLEDKKTRSLMMLPTDYVLTQDKSFKKYAKAYAEDQDLWFKDFSNVVSRLFELGVPENQFVTSEHWIMKNVDEQKN

Retrieve as FASTA  
Remarks Complete sequence from genomic (9 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCACTGCCTTCCGCGCCCCTCTTCGCAGAGCTGTCGTCTCTGCCGCTACCCCAAGGGCTGCATTTAGATCATCCTATCGAAGGTTCACTACTACCCCACCCGAACCAAGGCCA
AAGTCAAATACCCCCCTCTTTATTGGAATTGGCGCTTTCGTTACCGCCGGTGCTTTTGCACTCTACGCTTATTCTGATTCCGGAAAGGATGCTGCCACCTCCGTTAAATCTGGTATCCAA
GCCGCGAGGGTTGCAACGAGGTTCGTGCCAACAAAGGATGATTATCAGAAG
GTAATTTTTTTTTTTCACTCATCATACTGCTGGGGGACTCATTCTTGTTAGGTTTACAACCGAATTGCC
GAAGTCATGGATGACGCTGGCGACTATGATG
GTAGGTGTTTCTAGCTTCCCCTTTACATGTCAAGATGACTCATTCGGCCCTAGATGGCTCCTATGGTCCAGTGCTCCTGAGACTTGCCT
GGCACTCGTCTGGCACATACGACAAGGAGACGAAGACTGGTGGAAG
GTAAAGTGTTTTCTATCAAACTGCTATACAACTCGTCAATCACTCACCAATATCATTTAGCAACTTCGCTACGA
TGCGCTTCGAGCCCGAGTCTTTACACGGCGCTAACAATGGTCTGGGGGTTGCGCGCGGCTTAATGGAGAAGGTCAAGGCCGAGTTCCCCTGGTTGAGCTACGGTGACCTATGGACCCTTG
CTGGGGTCGTTGCCATTCAG
GTACGTCCCTCTTTTAACGTGTTTCTCGCCCGAAATGTTCATTCATTGCTCTCAGGAAATGGCTGGTCCCAAGATTCCCTGGCGTCCTGGTCGCATCGAT
GGCTTTGCTACAGACGCCACCCCTGACGGCCGTCTCCCCGATGCCAGTCAGGCATCTGATCATTTGAGGGCT
GTATGTAATATTGAATTCCCCTTGTTTACTCGCAATGACCCGGAGTCT
AGATTTTCTATCGCATGGGCTTCAACGACCAAGAAATTGTTGCACTATCCGGTGCGCATGCTCTTGGCCGCTGCCACAGTGATCGGTATGTCATGAGAACATTTGACGAATAAGCTACAA
TACCCATGACATCATATTCTTCCCAGCTCTGGCTTCGAGGGACCGTGGACTTTTTCACCTATAACCCTGACAAACGACTATTATAAACTCTTGTTTGATGAGAAGTATGTCATCTTCCTA
TTAGTCTTACGTGGATTTTCTCACGTTGATTCAGGTGGGTATGGAAGAAGTGGAATGGTCCTAAGCAACTTGAGGATAAGAAGACACGTTCGCTCATGATGCTGCCGTACGTTATTGTCT
CTGATGCATATAGTAAACCACAAATTAACCGGAGATGTGTAGTACCGACTACGTTTTAACTCAGGATAAAAGCTTTAAGAAGTATGCCAAGGCATATGCCGAAGATCAAGATCTTTGGTT
CAAGGA
GTAGGCACCTTTATTTCTTTTGCCTTCACGAATGTCATCAATTTATAATACCTTTTAGCTTTTCTAACGTCGTCTCGCGTCTCTTTGAGCTTGGCGTTCCCGAAAACCAGTTTG
TTACATCGGAACACTGGATCATGAAGAATGTTGATGAGCAAAAGAACTAG

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCACTGCCTTCCGCGCCCCTCTTCGCAGAGCTGTCGTCTCTGCCGCTACCCCAAGGGCTGCATTTAGATCATCCTATCGAAGGTTCACTACTACCCCACCCGAACCAAGGCCA
AAGTCAAATACCCCCCTCTTTATTGGAATTGGCGCTTTCGTTACCGCCGGTGCTTTTGCACTCTACGCTTATTCTGATTCCGGAAAGGATGCTGCCACCTCCGTTAAATCTGGTATCCAA
GCCGCGAGGGTTGCAACGAGGTTCGTGCCAACAAAGGATGATTATCAGAAG
GTTTACAACCGAATTGCCGAAGTCATGGATGACGCTGGCGACTATGATGATGGCTCCTATGGTCCAGTG
CTCCTGAGACTTGCCTGGCACTCGTCTGGCACATACGACAAGGAGACGAAGACTGGTGGAAG
CAACTTCGCTACGATGCGCTTCGAGCCCGAGTCTTTACACGGCGCTAACAATGGTCTG
GGGGTTGCGCGCGGCTTAATGGAGAAGGTCAAGGCCGAGTTCCCCTGGTTGAGCTACGGTGACCTATGGACCCTTGCTGGGGTCGTTGCCATTCAG
GAAATGGCTGGTCCCAAGATTCCC
TGGCGTCCTGGTCGCATCGATGGCTTTGCTACAGACGCCACCCCTGACGGCCGTCTCCCCGATGCCAGTCAGGCATCTGATCATTTGAGGGCT
ATTTTCTATCGCATGGGCTTCAACGAC
CAAGAAATTGTTGCACTATCCGGTGCGCATGCTCTTGGCCGCTGCCACAGTGATCG
CTCTGGCTTCGAGGGACCGTGGACTTTTTCACCTATAACCCTGACAAACGACTATTATAAACTC
TTGTTTGATGAGAA
GTGGGTATGGAAGAAGTGGAATGGTCCTAAGCAACTTGAGGATAAGAAGACACGTTCGCTCATGATGCTGCCTACCGACTACGTTTTAACTCAGGATAAAAGCTTT
AAGAAGTATGCCAAGGCATATGCCGAAGATCAAGATCTTTGGTTCAAGGA
CTTTTCTAACGTCGTCTCGCGTCTCTTTGAGCTTGGCGTTCCCGAAAACCAGTTTGTTACATCGGAACAC
TGGATCATGAAGAATGTTGATGAGCAAAAGAACTAG

Retrieve as FASTA