Entry information : AmusCcP01
Entry ID 11654
Creation 2013-02-27 (Christophe Dunand)
Last sequence changes 2013-02-27 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-07-26 (Catherine Mathe (Scipio))
Peroxidase information: AmusCcP01
Name AmusCcP01
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Agaricomycetes Amanitaceae Amanita
Organism Amanita muscaria    [TaxId: 41956 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value AmusCcP01
start..stop
S start..stop
AthiCcP01 615 0 1..375 1..369
ScomCcP 572 0 2..377 4..377
SlacCcP01 563 0 1..376 1..371
PoCcP_PC9 561 0 1..376 1..372
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 129528..129836 309 N° 2 129896..129944 49 N° 3 129999..130080 82 N° 4 130142..130412 271
N° 5 130469..130551 83 N° 6 130606..130755 150 N° 7 130814..130897 84 N° 8 130963..131080 118
join(129528..129836,129896..129944,129999..130080,130142..130412,130469..130551, 130606..130755,130814..130897,130963..131080)


exon

Literature and cross-references AmusCcP01
DNA ref. JGI genome:   scaffold_15 (129528..131080)
Cluster/Prediction ref. JGI gene:   75166
Protein sequence: AmusCcP01
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   382
PWM (Da):   %s   42390.14  
PI (pH):   %s   8.56
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSFSLLRAPARRAFLSTATPRAAFRSSYRRYTTSTPPPPPPPKSSNTGLFVGVGVASLAAGAFYYYYSIASPSGADAATTAKSAAQAVKVATGFVPTKEDYQKVYNRIAQVIDDAGEYDDGSFGPVLLRLAWHASGTYDKESNTGGSNYATMRFEPESLHGANNGLHIARQLMEQVKAEFPWISYGDLWTLAGVCAVQEMAGPHIPWRAGRIDGVVANATPDGRLPDASQGPDHLRIFYRMGFNDQEIVALSGAHALGRCHRDRSGFEGPWTFAPTTVTNDFFKLLFNERWVWKKWDGPKQLEDKKTRSLMMLPTDYSLTQDKSFKKHAKAYADDQDLWFKDFSNVLTRLFELGVPEKQFVTQDHWILKTVDEQNEKTSS

Retrieve as FASTA  
Remarks Complete sequence from genomic (7 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTCCCTCCTGCGCGCTCCCGCTCGTAGAGCATTCTTATCTACAGCTACTCCCCGAGCTGCATTCAGGTCTTCTTACCGGAGGTACACAACCTCTACACCACCACCACCACCA
CCACCGAAAAGCTCAAACACAGGCTTGTTTGTCGGTGTAGGAGTAGCTTCACTCGCTGCTGGTGCTTTTTACTACTACTATTCCATCGCATCCCCCTCGGGTGCGGATGCTGCTACGACT
GCTAAATCGGCTGCTCAGGCAGTAAAGGTTGCTACTGGTTTTGTGCCAACGAAAGAGGATTATCAAAAG
GTGTGTTGCTTTCCGGTTTTACACGAGGTTGGGTGACTAATGTATTCCTTC
GTGTGTAGGTCTATAACAGGATTGCGCAAGTCATTGACGACGCGGGAGAATACGACGGTATGCGGCGTTCGACGTGGATACTCGGTTCATTTTTTTTGATCACTTCTTTAGATGGCTCGT
TTGGCCCCGTTCTTCTCAGGCTTGCCTGGCATGCTTCCGGCACTTATGACAAGGAGAGCAACACTGGTGGCAG
GTATGTCACATCTTACCTAAACCCTTGAACGCTCGCCGTAATAACCC
GTCCGTCATGACAGCAACTATGCAACTATGCGGTTCGAACCTGAATCCCTTCACGGTGCCAACAACGGGCTTCATATCGCCCGTCAGCTGATGGAACAAGTCAAAGCGGAGTTCCCCTGG
ATCAGTTATGGAGATTTGTGGACTCTGGCTGGTGTCTGTGCCGTCCAGGAGATGGCTGGCCCGCATATACCTTGGCGTGCGGGTCGCATTGATGGTGTTGTTGCAAACGCGACTCCAGAT
GGTCGTTTGCCCGATGCATCTCAGGGACCTGATCATTTGAGAAAT
GTAATGTGCAATCGTGTCAATCTACGCGTACAAGCAGTGAACTTTTTGCTAAACAGATCTTCTACCGTATGGGAT
TCAATGATCAAGAAATTGTCGCGCTTTCTGGTGCTCACGCTCTTGGTCGCTGTCACCGTGACCG
GTAATATTATCCTCCCCTTCCTTCTTTGCAGCACCTTATCTATTCTACATACAGCT
CTGGATTCGAAGGTCCCTGGACATTCGCCCCCACCACTGTAACAAACGACTTTTTCAAACTCTTATTCAATGAAAGGTGGGTTTGGAAGAAGTGGGACGGCCCTAAGCAGCTCGAGGATA
AGAAGACCCGTTCGCTTATGATGCTTCC
GTAAGTCACGCATTCCCTGCTCATTCTTATTTTACTTAATGAATGTGCGCGCATACAGAACCGATTATTCTTTGACACAAGACAAGAGTTTC
AAGAAGCACGCCAAGGCGTATGCTGATGACCAGGACCTGTGGTTCAAAGA
GTGCGTTGCTGCTCTCACGCACAGTTCCGTATCTGTTGTACTGACACTCTTCTCTTTCACGCTAGCTTTT
CCAATGTCCTCACCCGTCTTTTCGAACTTGGTGTTCCGGAGAAACAGTTTGTGACTCAGGATCATTGGATCTTGAAGACGGTAGATGAACAGAATGAGAAAACGTCTTCATGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCCTTCTCCCTCCTGCGCGCTCCCGCTCGTAGAGCATTCTTATCTACAGCTACTCCCCGAGCTGCATTCAGGTCTTCTTACCGGAGGTACACAACCTCTACACCACCACCACCACCA
CCACCGAAAAGCTCAAACACAGGCTTGTTTGTCGGTGTAGGAGTAGCTTCACTCGCTGCTGGTGCTTTTTACTACTACTATTCCATCGCATCCCCCTCGGGTGCGGATGCTGCTACGACT
GCTAAATCGGCTGCTCAGGCAGTAAAGGTTGCTACTGGTTTTGTGCCAACGAAAGAGGATTATCAAAAG
GTCTATAACAGGATTGCGCAAGTCATTGACGACGCGGGAGAATACGACGAT
GGCTCGTTTGGCCCCGTTCTTCTCAGGCTTGCCTGGCATGCTTCCGGCACTTATGACAAGGAGAGCAACACTGGTGGCAG
CAACTATGCAACTATGCGGTTCGAACCTGAATCCCTTCAC
GGTGCCAACAACGGGCTTCATATCGCCCGTCAGCTGATGGAACAAGTCAAAGCGGAGTTCCCCTGGATCAGTTATGGAGATTTGTGGACTCTGGCTGGTGTCTGTGCCGTCCAGGAGATG
GCTGGCCCGCATATACCTTGGCGTGCGGGTCGCATTGATGGTGTTGTTGCAAACGCGACTCCAGATGGTCGTTTGCCCGATGCATCTCAGGGACCTGATCATTTGAGAAAT
ATCTTCTAC
CGTATGGGATTCAATGATCAAGAAATTGTCGCGCTTTCTGGTGCTCACGCTCTTGGTCGCTGTCACCGTGACCG
CTCTGGATTCGAAGGTCCCTGGACATTCGCCCCCACCACTGTAACA
AACGACTTTTTCAAACTCTTATTCAATGAAAGGTGGGTTTGGAAGAAGTGGGACGGCCCTAAGCAGCTCGAGGATAAGAAGACCCGTTCGCTTATGATGCTTCC
AACCGATTATTCTTTG
ACACAAGACAAGAGTTTCAAGAAGCACGCCAAGGCGTATGCTGATGACCAGGACCTGTGGTTCAAAGA
CTTTTCCAATGTCCTCACCCGTCTTTTCGAACTTGGTGTTCCGGAGAAACAG
TTTGTGACTCAGGATCATTGGATCTTGAAGACGGTAGATGAACAGAATGAGAAAACGTCTTCATGA

Retrieve as FASTA