Entry information : CqueCcP02
Entry ID 11655
Creation 2013-02-28 (Christophe Dunand)
Last sequence changes 2013-02-28 (Christophe Dunand)
Sequence status complete
Reviewer Not yet reviewed
Last annotation changes 2013-08-20 (Catherine Mathe (Scipio))
Peroxidase information: CqueCcP02
Name CqueCcP02
Class Cytochrome C peroxidase    [Orthogroup: CcP001]
Taxonomy Eukaryota Fungi Basidiomycota Cronartiaceae Cronartium
Organism Cronartium quercuum     [TaxId: 60197 ]
Cellular localisation N/D
Tissue type N/D
Inducer N/D
Repressor N/D
Best BLASTp hits
Perox score E-value CqueCcP02
start..stop
S start..stop
MlpCcP02 580 0 1..371 4..375
PUtriCcP02 542 0 51..372 62..384
PgrCcP02 542 0 51..372 61..383
HrufCcP01 429 4e-151 29..374 21..371
Gene structure Fichier Exons
ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize ExonStart..EndSize
N° 1 830603..831049 447 N° 2 830254..830538 285 N° 3 829926..830179 254 N° 4 829712..829850 139
complement(join(829712..829850,829926..830179,830254..830538,830603..831049))


exon

Literature and cross-references CqueCcP02
DNA ref. JGI genome:   scaffold_7 (831049..829712)
Cluster/Prediction ref. JGI gene:   651514
Protein sequence: CqueCcP02
Sequence Properties
first value : protein
second value (mature protein)
Length (aa):   %s   374
PWM (Da):   %s   41876.9  
PI (pH):   %s   8.16
Sequence
Send to BLAST
Send to Peroxiscan
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
MSLRPIFNRTFPKQSIHRFSINYSYSRLLSTTIHPNPNPNPDSSASPPPKKSSNTLLFGSLGLGVIGLAYYILKDDSSDIQSRYTTPKSANKSLDYQQIYNEIAALLDNNDYDDGSYAPVLVRLAWHASGTYDKESKTGGSNGATMRFAPESDHGANAGLGVARDLLEAIYKKYGPKGLTYSDLWTLAGVVAIQEIGGPKILWRPGRQDGIGPQNCTPDGRLPDGDKDQDHIRKIFYRMGFNDQEIVALSGAHALGRCHPDRSGFEGPWTFSPTTFTNDYYKLLFEEKWQPKKWKGPTQYEDVKTKSLMMLTTDMSLVMDKNFRSYAKKYASDEQAFFNDFSKAFAKLIELGVPEQNFGDKEPFHLKKLDEQEA

Retrieve as FASTA  
Remarks Complete sequence from genomic (3 introns).
DNA
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTTCGTCCAATCTTCAATAGAACCTTCCCTAAACAGTCTATACATCGTTTCTCTATAAACTATTCTTACTCCCGTTTACTATCCACTACTATCCATCCAAACCCAAACCCAAAC
CCAGACTCATCCGCCTCACCACCACCCAAGAAATCATCAAACACTCTCCTATTCGGTTCTTTAGGCTTAGGAGTAATCGGATTAGCATATTATATTTTAAAAGATGATAGTAGTGACATC
CAATCACGTTATACGACTCCTAAATCGGCTAATAAGTCACTTGACTATCAACAAATTTATAACGAGATAGCAGCTCTTCTGGATAATAACGATTACGATGACGGTTCTTATGCTCCTGTA
CTCGTTAGATTAGCTTGGCATGCTTCAGGTACATATGATAAAGAATCTAAAACAGGTGGTAGTAATGGAGCAACCATGAGATTCGCT
GTAAGTCTATTAATCCATTTCCCTTACCTAGTC
AATCGATTGACCATCTATCTATCAAACATAGCCAGAGAGTGATCATGGAGCGAACGCAGGTTTAGGAGTAGCAAGAGATTTACTTGAAGCGATTTATAAAAAATACGGTCCAAAGGGTTT
AACTTATTCAGATTTATGGACTTTGGCTGGAGTAGTAGCCATACAAGAGATTGGAGGACCTAAGATCTTGTGGAGACCTGGTAGACAAGATGGTATTGGACCTCAAAATTGTACACCTGA
TGGTAGATTACCTGATGGAGATAAAGATCAAGATCATATTCGAAAGATTTTTTATAGAATGGGGTTTAATGATCAA
GTATGTTTCCAAAAAAAAGGCTCTTTCGGACTATGTTTTTTTAT
TGACTTTTTATTTATTTATTTCAATTGTAGGAAATTGTGGCTCTCTCAGGTGCTCATGCATTAGGACGTTGTCATCCAGATCGATCAGGTTTCGAAGGCCCTTGGACTTTCTCACCAACA
ACCTTTACCAATGATTATTATAAATTATTATTTGAAGAGAAATGGCAACCTAAGAAATGGAAAGGTCCAACTCAATATGAGGATGTTAAAACTAAATCTTTAATGATGTTAACTACTGAT
ATGAGTTTAGTTATGGATAAGAACTTTAGATCTTATGCTAAAAA
GTAAGTGTCTTTCAATCATTTTTTCTTTCTTTTTGATTTCATTTATGACATCTTATTGACTTTTTTTCCGCTTAGG
TACGCGAGTGACGAGCAAGCTTTCTTTAATGACTTTAGCAAAGCTTTTGCAAAATTAATTGAATTAGGTGTTCCTGAACAAAACTTTGGTGATAAAGAACCGTTTCACTTAAAGAAATTA
GATGAACAAGAAGCTTGA

Retrieve as FASTA  
CDS
Send to BLAST
.........1.........2.........3.........4.........5.........6.........7.........8.........9.........0.........1.........2
ATGTCACTTCGTCCAATCTTCAATAGAACCTTCCCTAAACAGTCTATACATCGTTTCTCTATAAACTATTCTTACTCCCGTTTACTATCCACTACTATCCATCCAAACCCAAACCCAAAC
CCAGACTCATCCGCCTCACCACCACCCAAGAAATCATCAAACACTCTCCTATTCGGTTCTTTAGGCTTAGGAGTAATCGGATTAGCATATTATATTTTAAAAGATGATAGTAGTGACATC
CAATCACGTTATACGACTCCTAAATCGGCTAATAAGTCACTTGACTATCAACAAATTTATAACGAGATAGCAGCTCTTCTGGATAATAACGATTACGATGACGGTTCTTATGCTCCTGTA
CTCGTTAGATTAGCTTGGCATGCTTCAGGTACATATGATAAAGAATCTAAAACAGGTGGTAGTAATGGAGCAACCATGAGATTCGCT
CCAGAGAGTGATCATGGAGCGAACGCAGGTTTA
GGAGTAGCAAGAGATTTACTTGAAGCGATTTATAAAAAATACGGTCCAAAGGGTTTAACTTATTCAGATTTATGGACTTTGGCTGGAGTAGTAGCCATACAAGAGATTGGAGGACCTAAG
ATCTTGTGGAGACCTGGTAGACAAGATGGTATTGGACCTCAAAATTGTACACCTGATGGTAGATTACCTGATGGAGATAAAGATCAAGATCATATTCGAAAGATTTTTTATAGAATGGGG
TTTAATGATCAA
GAAATTGTGGCTCTCTCAGGTGCTCATGCATTAGGACGTTGTCATCCAGATCGATCAGGTTTCGAAGGCCCTTGGACTTTCTCACCAACAACCTTTACCAATGATTAT
TATAAATTATTATTTGAAGAGAAATGGCAACCTAAGAAATGGAAAGGTCCAACTCAATATGAGGATGTTAAAACTAAATCTTTAATGATGTTAACTACTGATATGAGTTTAGTTATGGAT
AAGAACTTTAGATCTTATGCTAAAAA
GTACGCGAGTGACGAGCAAGCTTTCTTTAATGACTTTAGCAAAGCTTTTGCAAAATTAATTGAATTAGGTGTTCCTGAACAAAACTTTGGTGAT
AAAGAACCGTTTCACTTAAAGAAATTAGATGAACAAGAAGCTTGA

Retrieve as FASTA